Tfome Clone Information

TFome Information for pUT3206

TFome Name pUT3206
Template EE174967
Genbank Insert ID JX469945
Protein Name ZmMYB106
Species Maize
TF Family MYB
Gene ID GRMZM2G048910
transcript T01
Vector pENTR/SD/D-TOPO
Note c.C557T p.P186L Not in functional domain. Not in template FlcDNA.
Request Information: Deposited to ABRC
5' Primer Name: C154_F 3' Primer Name: C154_R
5' Primer Tm (º C): 73.5 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGAGGCAGCCGTGCT 3' Primer Sequence: TATTCTGTGGTCGTCTTCTTGGTCGAA
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGGGAGGCAGCCGTGCTGCGACAAGGTTGGCGTGAAGAAGGGCCCGTGGACGGCGGAGGAGGACCAGAAGCTCGTCGGCTTCCTCCTCACCCACGGTCACTGCTGCTGGCGCGTCGTCCCCAAGCTCGCAGGGTTGCTGAGGTGCGGGAAGAGCTGCAGGCTGCGGTGGACCAACTACCTGAGGCCGGACCTCAAGAGGGGCCTGCTCTCCGACGACGAGGAGAGGCTCGTCATCGACCTGCACGCGCAGCTCGGGAACAGGTGGTCCAAGATCGCGGCGCAGCTACCGGGCAGGACGGACAACGAGATCAAGAACCACTGGAACACACACATCCGCAAGAAGCTCGTCCGGATGGGGATCGACCCCGTCACCCACCTGCCGTTGCAGGAACCGCCGGCTCCTGCTCCTGCTCCCGCCGAGCAGCAGGAGCAGAGCCACAGGCAGCAAGAAGAACTGCAACTGCAAGAGCTGCAGAACGGCCGCGAGCTTATCATGCAGGAGGGCGCGGGGGAAGACGATATCACGCCGATGATCCAGCCGCACGAGATCATGCTGACGGCGGCAGCGGCAAGCAACTGCGGCTCTGTTTCCTCTGCCCACGCCGGCTCCGCGTCCGTGGTCTCGCCGTCCTGCTCCTCCTCGGCGGTGTCCGGCGTGGAGTGGCCGGAGCCCATGTACCTGCTCGGCATGGATGGCATCATGGACGCCGACTGGGGCAGCCTCTTCCCCGACACTGGCGCTGGCGGCGGCGGCGGCGGCTTCGACTTGGGCGTCGATCCGTTCGACCAGTACCCGGGCGGTGGCTTCGACCAAGAAGACGACCACAGAATA
TFome clones do not contain stop codon at 3'end.
translation: MGRQPCCDKVGVKKGPWTAEEDQKLVGFLLTHGHCCWRVVPKLAGLLRCGKSCRLRWTNYLRPDLKRGLLSDDEERLVIDLHAQLGNRWSKIAAQLPGRTDNEIKNHWNTHIRKKLVRMGIDPVTHLPLQEPPAPAPAPAEQQEQSHRQQEELQLQELQNGRELIMQEGAGEDDITPMIQPHEIMLTAAAASNCGSVSSAHAGSASVVSPSCSSSAVSGVEWPEPMYLLGMDGIMDADWGSLFPDTGAGGGGGGFDLGVDPFDQYPGGGFDQEDDHRI