Tfome Clone Information

TFome Information for pUT3444

TFome Name pUT3444
Template BT041936.1
Genbank Insert ID KJ726899
Protein Name ZmMYB59
Species Maize
TF Family MYB
Gene ID GRMZM2G093789
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B290_F 3' Primer Name: B290_R
5' Primer Tm (º C): 67.8 3' Primer Tm (º C):
5' Primer Sequence: caccATGACGGTGGTGAGGGTG 3' Primer Sequence: CTGAGAGAGATGTGACTGGTCCT
PCR Condition: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l pr
Nucleotide Sequence: ATGACGGTGGTGAGGGTGGACGAGAACCCTGCGCCGGATGGAGAGAACTCTCCCCTAGACGATGAGTACGTCTCGGCCGACGATGAACACGTTGATGATGAAGACAAGGAGACCGATAGCATCGACGACTATGAAAACCCCAGCGGGACGCCCCAGATGAAGAAGGGTCCCTGGTCGCCCGAAGAGGATAAGCGTCTCAAAGACTACGTCGAGGTACACGGCGCGGGGAACTGGAATAAGGTGCAGCAGAATGCCAGGCTCAACCGCTGTGGCAAGAGCTGTCGTCTCCGCTGGACGAACCACCTCAGGCCCGATCTTAAGAAGGAGCCTTTCAACGCTGAGGAAGAGGAAAAGATAATCAAGCTTCACATTAGACGGGGCCCCAAGTGGTCCATGATGGCCTCATATTTGCCTGGCCGCACAGATAATGAAATAAAGAACTTTTGGAATACCAGAAAAAGAAGAAAACAGAGATGTGGTTCGCCTCTCTATCCAGAATATATGCTTTCTCAGGTTAGTCATAAAGACATGGACTTTGAAACTCTTGGAGAGTCACATGGCAAGAAACGGTCAAATGAGTGCTCAAAAGAAAAGGTTGTTGATGTGCAAGAACTTGTGGATGAGTTAATTGTATTTGAGCACCTTGACTATGGTAAGGATATAGTGTTTCCAATCAGACCTTTGAAATGCCATGCATCTACTGGCAGTGTGCAAATTTCTGGTGACATTCGGAAAACCTTTTGTCCCACTGATTTGAACTATGTAATGACAAAGAATCAGTCGGTGCCTGTTGGTAGTGCCATTGGCAGTGGCTATCCAGTATATGGTGGCAGACTCTCTACTTCAGGGACCATATTCGGTTCCATTCAGACAGAGATTCCTTCGATCCAAAGTTCCAGCTATAGCCCAAGTAATGACTGGTTGGCTCAATGTCCTTCGGCTTGCATTGAGCAACGGATTCCAATGGAATGCAATACAATATCTCAGTCAAAAGCTTACCTTATGATGCATTCTTCTTCAGCTTTCTGTGCCCCTGAACATGATGCCTGTTCTGAAACTCAAGCTCCAGACTTATGTTCAGGTTCAGATGTTGTTTTCGACCCCAGCCAATGTTATCCAGTTGCTAGTTTTTCTGATCTTGGGATCTCGGATACACCACTAACATCAGGTTTCTTGAATGATATAACACTAGCAAGTTTGTTGAATGTCAATTTGAAGGACCTGTCACATCTCAACCGACAGGAACCTACCAATGATACATCACTTGGAGGAGCAAGTTTATTGAATGCTAATTTGAAGGACCAGTCACATCTCTCTCAG
TFome clones do not contain stop codon at 3'end.
translation: MTVVRVDENPAPDGENSPLDDEYVSADDEHVDDEDKETDSIDDYENPSGTPQMKKGPWSPEEDKRLKDYVEVHGAGNWNKVQQNARLNRCGKSCRLRWTNHLRPDLKKEPFNAEEEEKIIKLHIRRGPKWSMMASYLPGRTDNEIKNFWNTRKRRKQRCGSPLYPEYMLSQVSHKDMDFETLGESHGKKRSNECSKEKVVDVQELVDELIVFEHLDYGKDIVFPIRPLKCHASTGSVQISGDIRKTFCPTDLNYVMTKNQSVPVGSAIGSGYPVYGGRLSTSGTIFGSIQTEIPSIQSSSYSPSNDWLAQCPSACIEQRIPMECNTISQSKAYLMMHSSSAFCAPEHDACSETQAPDLCSGSDVVFDPSQCYPVASFSDLGISDTPLTSGFLNDITLASLLNVNLKDLSHLNRQEPTNDTSLGGASLLNANLKDQSHLSQ