Tfome Clone Information

TFome Information for pUT3445

TFome Name pUT3445
Template BT066005
Genbank Insert ID KJ726900
Protein Name ZmMYB89
Species Maize
TF Family MYB
Gene ID GRMZM2G040924
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B297_F 3' Primer Name: B297_R
5' Primer Tm (º C): 76.8 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGAGGGCGCCGTGCTGC 3' Primer Sequence: CTTGAACGCCGTGTCCAGG
PCR Condition: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l pr
Nucleotide Sequence: ATGGGGAGGGCGCCGTGCTGCGACAGGACCAAGGGCCTCAAGAAGGGGCCCTGGACGCCGGAGGAGGACAAGCTCCTCGTCGACTACATCCAGACCAACGGCCATGGCAGCTGGCGCCTGCTCCCCAAGCTCGCAGGGCTAAACCGGTGCGGCAAGAGCTGCCGACTGCGGTGGACGAACTACCTCCGGCCGGACATCAAGCGCGGGCCCTTCACATCCGAGGAGCAGAAGTCCATCGTCCAGCTCCACGCCATCGTCGGCAACAAGTGGTCCATGATCGCGGCGCAGCTCCCTGGCCGGACGGACAACGAGATCAAGAACTACTGGAACACGCACCTCAAGAAGCAGCTGCGTCGGATGGGCCTCGACGAGCCCCCGCCCGGCCCGGCCGCCGGCTGCCCCTCCGCGCGCCACATGGCGCAGTGGGAAACGGCCAGGCTCGAGGCGGAGGCGCGCCTCTCCCTCCTCGCCACCGCCGCCTCCTCCTCCTCCTGCGGCGCCATCGCGGCCACCTCCGCCTCATCCTCCTCCTCCACCGTGGACTTGAAGACCGCATGCGCCAGGCCCGCGGACATCTTCCTGCGCCTGTGGAGCTCGGACATCGGGGACTCCTTCCGCCGCAAGACGGCCGCGGCGCCCGTGGTCAAGAGGAAGGACGCGGTGATCAAGCAGGAGTCGCAGGCGCTGCTGCTGGGTCCCGGGGACGACTCCTCGGCCGCGTCCAACGAGACGGAGGTGGCGGAGGCGCTGGAGGAGTACCAGATGTTCCTCGACTTCGCCGGCGAAGAGCTGGGGCTGTTTCACGGCCGGCACGGCGGCTTCTCGCTGTTCCCGCCGCTCGACGTGCTCGCCGAGGCGTCCCTGGACACGGCGTTCAAG
TFome clones do not contain stop codon at 3'end.
translation: MGRAPCCDRTKGLKKGPWTPEEDKLLVDYIQTNGHGSWRLLPKLAGLNRCGKSCRLRWTNYLRPDIKRGPFTSEEQKSIVQLHAIVGNKWSMIAAQLPGRTDNEIKNYWNTHLKKQLRRMGLDEPPPGPAAGCPSARHMAQWETARLEAEARLSLLATAASSSSCGAIAATSASSSSSTVDLKTACARPADIFLRLWSSDIGDSFRRKTAAAPVVKRKDAVIKQESQALLLGPGDDSSAASNETEVAEALEEYQMFLDFAGEELGLFHGRHGGFSLFPPLDVLAEASLDTAFK