Tfome Clone Information

TFome Information for pUT3447

TFome Name pUT3447
Template BT084980.1
Genbank Insert ID KJ726902
Protein Name ZmMYB134
Species Maize
TF Family MYB
Gene ID GRMZM2G001824
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B302_F 3' Primer Name: B302_R
5' Primer Tm (º C): 64.7 3' Primer Tm (º C):
5' Primer Sequence: caccATGGACATGGACATGGC 3' Primer Sequence: GCAAAGGTCATCCAGGCTCCACA
PCR Condition: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l pr
Nucleotide Sequence: ATGGACATGGACATGGCCATGATGGGCTTCGATGAGGACCTAGACCAGGTGCTGGCGGCGATGGGCCCCGCCGACAGCTCGGCGACGTCGTCTGCGCCCAACGCCGCCGCACCAGCACCACTAGCTGTCGTCCCAGCAGGCAGCAGCGACGATGAGGAGGCCGCCGCCGCGGATAGCGCCGACGACCTCCGGAGGGGCCCCTGGACGGTGGACGAGGACATCCTCCTCGTCAACTACATCGCCGCCCACGGCGAGGGCCGCTGGAACTCGCTCGCCCGCTCCGCGGGCCTGAAACGCACCGGCAAGAGCTGCCGCCTGCGGTGGCTGAACTACCTGCGGCCCAACGTGCGGCGGGGCAACATAACCGCCGAGGAGCAGCTGCTGATCCTGGACCTGCACTCGCGCTGGGGCAACAGGTGGTCCAAGATCGCGCAGCAGCTCCCCGGGCGCACCGACAACGAGATCAAGAACTACTGGCGCACCCGCGTGCAGAAGCACGCCAGGCACCTCCGCTGCGACGTCAACAGCGCCCACTTCCGCCACATCGTGCGCCACGTCTGGATGCCTCGCCTGCGAGAGCGCGCCCAGGCCGGCGGCGTACAGGCTCCAGCTACCACCACGGCCAGCGCGCCGCCCGCGTGTTATAACTACTGCGGGAGCCAACACCTGGTGCAGCAGCAAGGCGCCCACCGCGGCGTGACGGCGGCGAGCGAAGCTCACCACCACCACCAATACTACAGCGAGCCGGCAGGCCCGACGTCGGCGGCCACGGCCCTCAGCCCCGACGACGCCTCCAGCGCGCTGCGGTCGTCGTCGCTCAGGGCGGACGACGCGTCGCATTACACTGCAGCTTACACTTACACCTCGGCGGCCACGGCGACCCCGACGACGAACGACCAAGGCTACGAACAAACTACGACTGACGACGACGTGTTCGCCGGGTCGACCACATCGGAGCTCCTCGTCACCGCTACCGGCGGCCCTGACGACGAGTACAGCTCCATGATCGGCCTGCAGCTGCAGGACTTTGGGTTTGAGGATTTCGAGTACGGCCTGTGGAGCCTGGATGACCTTTGC
TFome clones do not contain stop codon at 3'end.
translation: MDMDMAMMGFDEDLDQVLAAMGPADSSATSSAPNAAAPAPLAVVPAGSSDDEEAAAADSADDLRRGPWTVDEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPNVRRGNITAEEQLLILDLHSRWGNRWSKIAQQLPGRTDNEIKNYWRTRVQKHARHLRCDVNSAHFRHIVRHVWMPRLRERAQAGGVQAPATTTASAPPACYNYCGSQHLVQQQGAHRGVTAASEAHHHHQYYSEPAGPTSAATALSPDDASSALRSSSLRADDASHYTAAYTYTSAATATPTTNDQGYEQTTTDDDVFAGSTTSELLVTATGGPDDEYSSMIGLQLQDFGFEDFEYGLWSLDDLC