Tfome Clone Information

TFome Information for pUT4037

TFome Name pUT4037
Template Synthesized template
Genbank Insert ID KJ727035
Protein Name ZmMYB38
Species Maize
TF Family MYB
Gene ID GRMZM2G084583
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGCAGGTCCCCATGCTGCGAGAAGGCTCATACAAACAGGGGCGCCTGGACCAAGGAGGAGGACGAGAGACTGGTTGCCTACATCAGGGCTCATGGCGAGGGCTGCTGGCGCTCACTTCCAAAGGCTGCTGGCCTTCTTAGGTGCGGCAAGTCTTGCAGGCTGCGCTGGATCAACTACCTGAGGCCAGATCTGAAGAGGGGCAACTTCACCGCTGACGAGGACGACCTGATCGTGAAGCTGCATAGCCTGCTGGGCAACAAGTGGTCCCTGATCGCTGCTAGACTGCCAGGCAGGACCGACAACGAGATCAAGAACTACTGGAACACCCACGTGAGGCGCAAGTTGCTTGGCAGGGGCATCGATCCAGTGACCCACAGGCCAATCGCTGCTGATGCTGTGACCGTGACCACCGTGAGCTTCCAGCCATCTCCATCTGCAGCCGCCGCAGCTGCTGCTGAGGCTGAGGCTACTGCTGCTAAGGCTCCAAGGTGCCCAGACCTGAACCTGGACCTGTGCATCTCTCCACCGTGCCAGCAACAAGAAGAAGAGGAGGAGGTCGACCTGAAGCCAAGCGCTGCTGTTGTGAAGCGCGAGGTTTTGCTTGGCGGCAGAGGCCATGGGCATGGCGGCGCACTTTGCTTCGGCTGCTCACTTGGCGTTCAGAAGGGCGCTCCAGGCTGCTCTTGCTCTAGCTCTAATGGCCATAGATGCCTGGGCCTGAGGGGCGGCATGCTTGATTTCAGGGGCCTGAAGATGAAG
TFome clones do not contain stop codon at 3'end.
translation: MGRSPCCEKAHTNRGAWTKEEDERLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFTADEDDLIVKLHSLLGNKWSLIAARLPGRTDNEIKNYWNTHVRRKLLGRGIDPVTHRPIAADAVTVTTVSFQPSPSAAAAAAAEAEATAAKAPRCPDLNLDLCISPPCQQQEEEEEVDLKPSAAVVKREVLLGGRGHGHGGALCFGCSLGVQKGAPGCSCSSSNGHRCLGLRGGMLDFRGLKMK