Tfome Clone Information

TFome Information for pUT4076

TFome Name pUT4076
Template Synthesized template
Genbank Insert ID KJ727048
Protein Name ZmMYB1
Species Maize
TF Family MYB
Gene ID GRMZM2G005066
transcript T01
Vector pENTR/SD/D-TOPO
Note Sequence reference from Plant Cell, Vol. 5, 1795-1805, Cone et al.
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGGAGGAGGGCGTGTTGCGCGAAGGAAGGCGTTAAGAGAGGGGCGTGGACGAGCAAGGAGGACGATGCCTTGGCCGCCTACGTCAAGGCCCATGGCGAAGGCAAATGGAGGGAAGTGCCCCAGAAAGCCGGTTTGCGTCGGTGCGGCAAGAGCTGCCGGCTGCGGTGGCTGAACTACCTCCGGCCCAACATCAGGCGCGGCAACATCTCCTACGACGAGGAGGATCTCATCATCCGCCTCCACAGGCTCCTCGGCAACAGGTGGTCGCTGATTGCAGGCAGGCTGCCTGGCCGAACAGACAATGAAATCAAGAACTACTGGAACAGCACGCTGGGCCGGAGGGCAGGCGCCGGCGCCGGCGCCGGCGGCAGCTGGGTCGTCGTCGCGCCGGACACCGGCTCGCACGCCACCCCGGCCGCGACGTCGGGCGCCTGCGAGACCGGCCAGAATAGCGCCGCTCATCGCGCGGACCCCGACTCAGCCGGGACGACGACGACCTCGGCGGCGGCGGTGTGGGCGCCCAAGGCCGTGCGGTGCACGGGCGGACTCTTCTTCTTCCACCGGGACACGACGCCGGCGCACGCGGGCGAGACGGCGACGCCAATGGCCGGTGGAGGTGGAGGAGGAGGAGGAGAAGCAGGGTCGTCGGACGACTGCAGCTCGGCGGCGTCGGTATCGCTTCGCGTCGGAAGCCACGACGAGCCGTGCTTCTCCGGCGACGGTGACGGCGACTGGATGGACGACGTGAGGGCCCTGGCGTCGTTTCTCGAGTCCGACGAGGACTGGCTCCGCTGTCAGACGGCCGGGCAGCTTGCG
TFome clones do not contain stop codon at 3'end.
translation: MGRRACCAKEGVKRGAWTSKEDDALAAYVKAHGEGKWREVPQKAGLRRCGKSCRLRWLNYLRPNIRRGNISYDEEDLIIRLHRLLGNRWSLIAGRLPGRTDNEIKNYWNSTLGRRAGAGAGAGGSWVVVAPDTGSHATPAATSGACETGQNSAAHRADPDSAGTTTTSAAAVWAPKAVRCTGGLFFFHRDTTPAHAGETATPMAGGGGGGGGEAGSSDDCSSAASVSLRVGSHDEPCFSGDGDGDWMDDVRALASFLESDEDWLRCQTAGQLA