Tfome Clone Information

TFome Information for pUT4203

TFome Name pUT4203
Template Synthesized template
Genbank Insert ID KJ727091
Protein Name ZmMYB10
Species Maize
TF Family MYB
Gene ID GRMZM2G395672
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGCGCAAGCCGGCTGTTCAACAAAGAGGCGCTGGCGCTATCAGGACCCTTAAGAGAGGCGCTTGGACCCCAGAGGAGGATGAGCTTCTTGCTAGGGCCGTGGCTAAGGATGGCGAGGGGAGATGGCGCACTCTTCCAAGAAGGGCTGGCCTTCTTAGGTGCGGCAAGTCTTGCAGGCTGCGCTGGATGAACTACCTGAGGCCGGATATCAAGAGGGGCCCAATCGCTGCTGACGAGGAGGATCTGATCCTGAGGCTGCATAGGCTGCTGGGCAACAGGTGGTCACTTATCGCTGGCAGACTGCCAGGCAGGACCGACAACGAGGTGAAGAACTACTGGAACAGCCACCTGAGCAAGAAGCTGGTCGCTAGGGGCATCGATCCAAGGACCCATACTCCACTGCCAGCCGCTGCTGCTTCTCTGCACTCTCACTCTCACAGGGCTGACGACGATTCTCCAGCTGGCGCTGCTGGCAGCTCTGCTGATAAGACTCCACCACCACTGGTCGAGGTCGAGCCATCTGTTGCTCCACCACCAGCTCAGCCGAACAGCTCTTTCGGGGATGGCAGCTCTGGCGATTTCGCTGGCGGCATGATGGGCCTTGGCTCTGAGGGCTTCGATGGCGTTGGCGATCCATTCTGCGCTCCAGCTCCAGGCGGCTTCCATCTTGGCTGCCCAGTGGTGGATGACGCGACCTTCTCTAGCTTCCTGGACAGCCTGATGAACGAGGAGAGGATGAGGATCGCCGACTACATCGGCGACCACAGGGATGCTGATGGCGGCAATGATCAAGGCGGCGCTTAC
TFome clones do not contain stop codon at 3'end.
translation: MRKPAVQQRGAGAIRTLKRGAWTPEEDELLARAVAKDGEGRWRTLPRRAGLLRCGKSCRLRWMNYLRPDIKRGPIAADEEDLILRLHRLLGNRWSLIAGRLPGRTDNEVKNYWNSHLSKKLVARGIDPRTHTPLPAAAASLHSHSHRADDDSPAGAAGSSADKTPPPLVEVEPSVAPPPAQPNSSFGDGSSGDFAGGMMGLGSEGFDGVGDPFCAPAPGGFHLGCPVVDDATFSSFLDSLMNEERMRIADYIGDHRDADGGNDQGGAY