Tfome Clone Information

TFome Information for pUT4423

TFome Name pUT4423
Template Synthesized template
Genbank Insert ID KJ727134
Protein Name ZmMYB109
Species Maize
TF Family MYB
Gene ID GRMZM2G052606
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGCGCAAGCCAGAGTGCCCAGCTGCCAACTCTTCTAACGCTGGCGCTGCTGCTGCTAAGCTGAGGAAGGGCCTTTGGAGCCCAGAGGAGGATGAGAGGCTGGTCGCTTACATGCTGAGGTCTGGCCAGGGCTCTTGGTCCGATGTTGCTAGGAACGCTGGCCTTCAGAGGTGCGGCAAGTCTTGCAGGCTTCGCTGGATCAACTACCTGAGGCCGGATCTGAAGAGGGGCGCCTTCTCACCACAAGAGGAGGAGCTGATCGTTAGCCTGCACGCCATCCTTGGCAACAGGTGGTCACAGATCGCTGCTAGGCTTCCAGGCAGGACCGACAACGAGATCAAGAACTTCTGGAACAGCACCATCAAGAAGAGGCTGAAGAACAGCAGCGCCGCCAGCTCTCCAGCTGCTACTGATTGCGCTAGCCCAGAGCCGAACAACAAGGTTGCAGCTGCTGGCTCTTGCCCGGACCTGTCTGTGCTGGATCATCAGGATGGCGGCCACCACCATGCTATGACCACTACTACTGCCGGCCTGTGGATGGTGGACAGCTCTAGCTCTTGCACCAGCAGCACCAGCCCGATGCATCAGTTCCAGAGGCCAACCACCACCATGGCTGCTGCTGTTGCTTCTGGCTCTTACGGCGGCCTGGTGCCATTCCCAGATCAGGTTAGAGGCGTGGTGGCTGATACCGGCGGCTTCTTCCATGGCCATGCTGCCCCAGCTTTCAAGCACCAAGTGGCTGCACTTCATGGCGGCGGCTACTACTACGGCTCTGCTCCAAGACACCACGGCATGACCACCACCACCACTACCGTTGCTCTTGAGGGCTCTGGCGGCTGCTTCATTTCTGGCGAGGGCATGCTTGGCGTGCCACCACTTTTGCTCGAGCCAATGTCTGCCGCTCTCGAGCAGGATCAGGGCCAGACTCTGATGGCTAGCAGCGGCAACAACAACCCGAAGAACAACAGCAGCTCCAACACCACCGACACCACCACAACAACCACCCTGAGCAACAACGAGAGCAACGTGACCGATACCACCACCAAGGACAACACCACCAACACGATCAGCCAGGTGAACTCCGGCAGCAACAACGTGTACTGGGAGGGCGCTAGGCAGCAGTACATGAGCCGCAACGTTATGCACGGCGAGTGGGATCTCGAGGAGCTGATGAAGGATGTGAGCAGCCTGCCGTTCCTGGACTTCCAGGTTGAG
TFome clones do not contain stop codon at 3'end.
translation: MRKPECPAANSSNAGAAAAKLRKGLWSPEEDERLVAYMLRSGQGSWSDVARNAGLQRCGKSCRLRWINYLRPDLKRGAFSPQEEELIVSLHAILGNRWSQIAARLPGRTDNEIKNFWNSTIKKRLKNSSAASSPAATDCASPEPNNKVAAAGSCPDLSVLDHQDGGHHHAMTTTTAGLWMVDSSSSCTSSTSPMHQFQRPTTTMAAAVASGSYGGLVPFPDQVRGVVADTGGFFHGHAAPAFKHQVAALHGGGYYYGSAPRHHGMTTTTTTVALEGSGGCFISGEGMLGVPPLLLEPMSAALEQDQGQTLMASSGNNNPKNNSSSNTTDTTTTTTLSNNESNVTDTTTKDNTTNTISQVNSGSNNVYWEGARQQYMSRNVMHGEWDLEELMKDVSSLPFLDFQVE