Tfome Clone Information

TFome Information for pUT4425

TFome Name pUT4425
Template Synthesized template
Genbank Insert ID KJ727136
Protein Name ZmMYB82
Species Maize
TF Family MYB
Gene ID GRMZM2G167088
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGACCGTGGTCGAGGCTGGCGAGGTGCTGAATCTTAAGGTGGGCGAGAACCCACTGCTCGAGGGCGAGGCTAAGACTGGCTACGTGAGCCCAGATGACCAGGACGGCGAGACTGCTTCTGAGAAGCCATGCGGCGCTCCGCAGCTTAAGAAGGGCCCCTGGTCACCAGACGAGGACAAGCTGCTGAAGAACTACGTTGAGGCTCACGGCGAGGGCAAGTGGAACAAGGTGCAGAGGAACAGCGGCCTGAACAGGTGCGGCAAGTCTTGCAGGCTGAGGTGGACCAACCACCTGAGGCCAGATCTGAAGAAGGGCCCGTTCGACAACGAGGAGATCGACAAGATCCTGAAGTTCTACCTGAAGTGGGGCCCGAAGTGGGCCAAGATCGCTTCTAGACTTCCAGGCAGGACCGACAACGAGATCAAGAACTTCTGGAACACCAGGATCAAGAAGACCGAGAAGCAGGGCCTGCCGATCTACCCAGAGCATGTGCTGTCTCAGGTGAAGCAGCCGCAGCAGGACATGAACTGCGAGACTCCAGGCCTGAGCCACGGCAAGAAGAGGATCAGAGAGATCGAGATCCACGACCTGATGGACGTGAAGATCCTGTTCCAGCACCTGGACTACCACAAGGACCTGGTGGTGCCTACCAAGCCACTTAAGAGGCGCGCTTCTATCGGCAGCCTGAAGATCAGCGGCGAGACTAAGGAGACTTACTGCAGCACCGACCTGAACTACGTGCTGGCCAGGTCTGAGTCTGTGCCAACCGGCTCTGCTATCGCTAGCGGCTACCCAGTTGAGCTGCCATCCATCCAGAGCAGCAGCAGCACCCTGTCTAACGACTGGCTGCTGCAGTGCGTGAGCGCTTCTGTTGAGCAGCAGATCCACAGCAGCATCCAGAGCACCGAGACTATCAGCTCTCAGACCACCGGCCTGCTGCACACCATGAGCGAGATCAGCTTCGAGACTCTGATCCCGATGGTGTACCCGATGATCCACAGCTTCGGCTACAGCGAGCACGAGAGCAGCCCAAACACCGACATCCAGGCTGCTAACCTGAGCCTGGGCAGCGACGATGTGAGCCAGTACTACCAGGTGGCCAGCTTCTTCGATCCAGGCGTGCCAGATACTGAGCTGGGCGCCTCTTTCTTCAACGACACCCCTCCAGAGACTAGCTTCCTGAACCAGCAAAAGCAGGTCAGC
TFome clones do not contain stop codon at 3'end.
translation: MTVVEAGEVLNLKVGENPLLEGEAKTGYVSPDDQDGETASEKPCGAPQLKKGPWSPDEDKLLKNYVEAHGEGKWNKVQRNSGLNRCGKSCRLRWTNHLRPDLKKGPFDNEEIDKILKFYLKWGPKWAKIASRLPGRTDNEIKNFWNTRIKKTEKQGLPIYPEHVLSQVKQPQQDMNCETPGLSHGKKRIREIEIHDLMDVKILFQHLDYHKDLVVPTKPLKRRASIGSLKISGETKETYCSTDLNYVLARSESVPTGSAIASGYPVELPSIQSSSSTLSNDWLLQCVSASVEQQIHSSIQSTETISSQTTGLLHTMSEISFETLIPMVYPMIHSFGYSEHESSPNTDIQAANLSLGSDDVSQYYQVASFFDPGVPDTELGASFFNDTPPETSFLNQQKQVS