Tfome Clone Information

TFome Information for pUT4590

TFome Name pUT4590
Template Synthesized template
Genbank Insert ID KJ727200
Protein Name ZmMYB19
Species Maize
TF Family MYB
Gene ID GRMZM5G833253
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGCAGGGGCAGGGCTCCATGCTGCGCTAAGGTTGGCCTTAACAGGGGCAGCTGGACCCCGCAAGAGGACATGAGGCTGATCGCCTACATCCAGAAGCACGGCCACACCAATTGGAGGGCCCTTCCAAAGCAGGCTGGCCTTCTTAGGTGCGGCAAGTCTTGCAGGCTGCGCTGGATCAACTACCTGAGGCCAGATCTGAAGAGGGGCAACTTCACCGACGAAGAGGAGGAGGCCATCATCAGGCTGCATGGCCTGCTTGGCAACAAGTGGTCTAAGATCGCCGCTTGCCTGCCAGGCAGGACCGACAACGAGATCAAGAACGTGTGGAACACCCACCTGAAGAAGAAGGTCGCCCAGCGCGAGAAGAAGAAGGCTGGCGCTGGCTCTGGGGATGCTGGCACTCCAGCTACTGCTCCACTGAGCAGCGCTACCTCTTCTACCACCACCCACAATAGCAGCGGCGGCTCTGATTCTGGCGATCAGTGCGGCACTTCTCGCGAGCCAGATGCTACTGATGTGTGCCCACTGCAGCTCGAGGACATGGACGTGAGCGACATGCTGGTTGATGGCGCTCCACCAGCTGCTCAGCCAATGCCATCTCCAAGCAGCAGCAGCTCCCTGACTACTTGCGTTGGCGGCGTTGAGGAGCTGATCGAGCTGCCAGTGATCGACATCGAGCCAGAGATCTGGTCCATCATCGACGGCGAGTCTGCTGTGGCTAGACATGGCGGGGATGCTGCTGCTCCATGCACTGGCACAGGCACCGCTGTTTCTACCTCTGAGGCTGAGGAGGCCGCTGCTAACGATTGGTGGCTCGAGAACCTCGAGAAGGAGCTTGGCCTTTGGGGCTACGCTGAGGAGGATACCCAGGCTCATCCAGACCTGCTGGATCACTACACCGGCCTGTCTCCACTGTGCGCTCTTGAGGGCGATCCAGTGAGCACCTACTTCCAGACTGGCCCAGCTGCTGCTGAGCCAGAGCTGCTGGTTGTGGTTGAGCCATCTGCTGTGCTGCTG
TFome clones do not contain stop codon at 3'end.
translation: MGRGRAPCCAKVGLNRGSWTPQEDMRLIAYIQKHGHTNWRALPKQAGLLRCGKSCRLRWINYLRPDLKRGNFTDEEEEAIIRLHGLLGNKWSKIAACLPGRTDNEIKNVWNTHLKKKVAQREKKKAGAGSGDAGTPATAPLSSATSSTTTHNSSGGSDSGDQCGTSREPDATDVCPLQLEDMDVSDMLVDGAPPAAQPMPSPSSSSSLTTCVGGVEELIELPVIDIEPEIWSIIDGESAVARHGGDAAAPCTGTGTAVSTSEAEEAAANDWWLENLEKELGLWGYAEEDTQAHPDLLDHYTGLSPLCALEGDPVSTYFQTGPAAAEPELLVVVEPSAVLL