Tfome Clone Information

TFome Information for pUT4625

TFome Name pUT4625
Template Synthesized template
Genbank Insert ID KJ727235
Protein Name ZmMYB47
Species Maize
TF Family MYB
Gene ID GRMZM2G088783
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGCCACCACAGCTGCTGCAACAAGCAGAAGGTTCGCAGGGGCCTTTGGAGCCCAGAGGAGGATGAGAAGCTGGTCAAGTACATCACCGCTCACGGCCACGGCTGCTGGTCATCTGTTCCAAGACAGGCTGGCCTTCAGAGGTGCGGCAAGTCTTGCAGGCTTCGCTGGATCAACTACCTGAGGCCGGATCTGAAGAGGGGCAGCTTCTCTCAGCAAGAGGAGGCCCTGATCGTCGAGCTGCATAGGGTTCTGGGCAACAGGTGGGCCCAGATCGCTAAGCACCTTCCAGGCAGGACCGACAACGAGGTGAAGAACTTCTGGAACAGCACCATCAAGAAGAAGCTGATCAGCCAGGCCGTGGGCTCTCTGCACCCAGACCTGTACTACAACATCCTGGATGGCGGCGCTGCTGGCGCTCAAGATCTTGCTGCTGCTGGCTGCGCTCCACTGAACGGCGCTGATTCTGCTTCAGCTGCTGCTGCTCAGGCTGTGGGCGTTACCACTACTCAGCCAAGCCCATCTATGGCCCACGTGGACCCAGCTGCTGCTTGGGCTGCTGATTTCGGCTCTCAGACCCTGTTCCTTCCAGGCGGGGCTGCTGCACTTCAATACGCTGCTGCTGTTGAGGGCGAGTTCGTGAAGCAGTGCAGGACCGCTGCTGACGCTTGCTACCCACCAGAGCCAGAGGATGGCGGCGGCGGCGCTAGACAATGCAACAATCAAGCTGCCGCCGACGTGGTGACTGCTGCTGTTCAACCAGAGGGCGCTGGCCTGCCAGTTTTCCTTGAGCCAAAGTGCGCCGGCAGCTTCATGCCAGAGCCAGCTCTTGCTCCGGTGATGGACTTCATGGAGGCTATCCTGGGCAGCACCGCTGCTGCTAGCGCAGCTTCTGCTAGCTCTCTGGACGATACCTGCTTCAGCGCCAACGCTGGCATGCAGTCTCACTGCTGGATTCCG
TFome clones do not contain stop codon at 3'end.
translation: MGHHSCCNKQKVRRGLWSPEEDEKLVKYITAHGHGCWSSVPRQAGLQRCGKSCRLRWINYLRPDLKRGSFSQQEEALIVELHRVLGNRWAQIAKHLPGRTDNEVKNFWNSTIKKKLISQAVGSLHPDLYYNILDGGAAGAQDLAAAGCAPLNGADSASAAAAQAVGVTTTQPSPSMAHVDPAAAWAADFGSQTLFLPGGAAALQYAAAVEGEFVKQCRTAADACYPPEPEDGGGGARQCNNQAAADVVTAAVQPEGAGLPVFLEPKCAGSFMPEPALAPVMDFMEAILGSTAAASAASASSLDDTCFSANAGMQSHCWIP