Tfome Clone Information

TFome Information for pUT4752

TFome Name pUT4752
Template Synthesized template
Genbank Insert ID KJ727318
Protein Name ZmMYB118
Species Maize
TF Family MYB
Gene ID GRMZM2G160840
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGCCGCTACTCAATCTAGAGGCGGCGGTGGTGTTGTGCCAGTGCAAGTTGATGAAGAACATGGCAGAAGAAGGCAAGGCGGAGCCGCTCCACAAGAGGAAGAAGAAGAGGCTGCTGAGAAGCCAGAACTTAGAAGGGGCCCATGGACCGTGGATGAGGATCATATCCTGGTGAACTACATTGCCGACAATGGCGAGGGAAGGTGGAACTCTCTTGCTAGAGCTGCTGGCCTTAAGAGGACCGGTAAGTCTTGTAGGCTGCGCTGGCTTAACTACCTGAGGCCAGATGTTAAGAGGGGCAACTTCACCGCTGATGAGCAACTGCTGATCCTGGATCTGCATACCAGGTGGGGCAACAGGTGGTCTAAGATCGCTCAACATCTGCCAGGCAGGACCGACAACGAGATCAAGAACTATTGGAGGACCAGGGTGCAGAAGCACGCCAAGCAACTTAACTGCGACGCTAGCTCCAAGAGGTTCAAGGACGCTATGCGCTACCTGTGGATGCCACATCTGGTGGATGCTACCGCTACTGCTGACGATGAGTACCACCAGCATCAAGCCGCTGCTGCCGGCAATATTGATGGCCTTCTTGCTGGCGGTGATGTGGATCATGTGCAGCATGCTTTGGCTGCTGGTGTTGCTGCTGCTATGGCTTCCTCTAGCTCTGATTCTCTGGCCAGCGAGCCATACTCTTACGAGGATGGTGGTCTGCTCGCTTCTCTGAGGGCTGGTGATGATATGCAGCTCGTGATGTCAGGTGGTGGTTGGGCAGCTGCTCAAGCTCAAGAGGCTAACGATCAAGGCCTGTGGCCATCATCATCTGGTCATGGCCTTTCTAGCTCCGTTCAAGCTGCAGCAGGCGGTGCTGGTCAATTCGAAGATCCAGAGCTTTCTGGCTGGGTGCAGGGCTTCAGCGATTCAATCATCACTGGCAACCTGTGGGCCCTGGAAGAGATCTGGAAGATGCAA
TFome clones do not contain stop codon at 3'end.
translation: MAATQSRGGGGVVPVQVDEEHGRRRQGGAAPQEEEEEAAEKPELRRGPWTVDEDHILVNYIADNGEGRWNSLARAAGLKRTGKSCRLRWLNYLRPDVKRGNFTADEQLLILDLHTRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQLNCDASSKRFKDAMRYLWMPHLVDATATADDEYHQHQAAAAGNIDGLLAGGDVDHVQHALAAGVAAAMASSSSDSLASEPYSYEDGGLLASLRAGDDMQLVMSGGGWAAAQAQEANDQGLWPSSSGHGLSSSVQAAAGGAGQFEDPELSGWVQGFSDSIITGNLWALEEIWKMQ