Tfome Clone Information

TFome Information for pUT4753

TFome Name pUT4753
Template Synthesized template
Genbank Insert ID KJ727319
Protein Name ZmMYB74
Species Maize
TF Family MYB
Gene ID GRMZM2G028054
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGTACCGCGTGAAGTCTCAAGCTGAGGGTGAGGGCGAAGGCAAGGACGAGATGATGTCTCAGGACCAGATGGACAGCCCAGTGGACAACGATGTTTCTAGCTCTAGAAGGTCACCACGCAGAGGCGTTGGTGCTCCATTGAAGAAGGGACCTTGGACCGACGCTGAGGACGCTATCCTGATCGACTACGTTAAGAAGCACGGCGTCGGCAACTGGAACGCTGTGAGGAAGAATACTGAGCTGCTGAGGTGCGGCAAGTCTTGCAGACTTAGGTGGGCTAACCACCTGAGGCCGAACCTCAAGAAGGAAGCTTTCACCCCAGAGGAAGAGAGGCTGATCATCCAGCTGCATGCTAAGCTGGGCAACAAGTGGTCCAGGATGGCTATCCATCTTCCAGGCAGGACCGACAACGAGATCAAGAACTACTGGAACACCCGCAAGAAGAGGTGCGAGAGGGCTTCTTTGCCAATCTACCCAGCTGGCGTGAGGAACCAGTCTAGCAACGAGGATCAGCAACTGAGCGGCGATCTTAACGGCGGCGAGAACATGTCTAACGACCTGCTGTCTGGCAACAGCCTGTGCCTGCCAGACTTCAACAACGACAGCTTCAGGGCCAAGCTGAAGGCTCTGCCACCACAACTTCCAGCTGTGAGCATCTCTAACCTGCTGGGCCAGAGCTTCGCTTCTAAGGGCTGCTCTTTCATGGACCAGGTTGACCAGGCTGGCATGCTGAAGCAATCTGGTTCTGCTCTCCCAACCCTGTCTGACGCCATCGACGATGTGATCTCTAGCGTGGACCAGTTCTCCAACGACTCCGAGAAGCTGATGCAGACTCTTGGCTTCGGCTACCTGAACGAGGCTAACGCTACCAGCAAGTCTATCGCTCCATTCGGCGTTGCCCTGACTGGATCTCATGCTCCACTGAACGGCATCTTCAGCGCTTCTAGGCTTACCAACGGCCCGAGCAAGATGGAACCACCATCTGTGCAAAACTCCAGGCTGAAGTACACCGTGGACCCAGCTATGCAGCCAACCGAACTGGTTGATCCGTACATGCAGTCTCTGAGCGCTACCCCAAGCGTTAAGTCTGAATGTGCTAGCCCTAGGAACAGCGGCCTGTTCGAGGAACTTCTGCATGAGCCACATGCTCTCAGAAGCGGCAAGAGCCAACAGCCATCTGTTAGGTCTAGCAGCTCTAGCGCTGGTACTCCATACGGCACTATGGTGTCTAGCGAGTTCGACATGGGGCAAGAGTACTGGGAGGAACAACCAGGCTCTCTGCTTAGCGAGTACGCTCATTTCAGCGGCAACTACCTTGCTGAGTGCGCTCCACCAGTTAGCGCTGCTTCTACCGATATCTTCCCGCTGCCAAAGATCAGCCCAGCTGAGTCTCCATCTATGGGCTCTGGTGAGCAAGCTCTCGAGCCAAAGCACGAATCTGCTGCCTCTAGGACTAGCTCCTGGAAGCTTGAAGCT
TFome clones do not contain stop codon at 3'end.
translation: MYRVKSQAEGEGEGKDEMMSQDQMDSPVDNDVSSSRRSPRRGVGAPLKKGPWTDAEDAILIDYVKKHGVGNWNAVRKNTELLRCGKSCRLRWANHLRPNLKKEAFTPEEERLIIQLHAKLGNKWSRMAIHLPGRTDNEIKNYWNTRKKRCERASLPIYPAGVRNQSSNEDQQLSGDLNGGENMSNDLLSGNSLCLPDFNNDSFRAKLKALPPQLPAVSISNLLGQSFASKGCSFMDQVDQAGMLKQSGSALPTLSDAIDDVISSVDQFSNDSEKLMQTLGFGYLNEANATSKSIAPFGVALTGSHAPLNGIFSASRLTNGPSKMEPPSVQNSRLKYTVDPAMQPTELVDPYMQSLSATPSVKSECASPRNSGLFEELLHEPHALRSGKSQQPSVRSSSSSAGTPYGTMVSSEFDMGQEYWEEQPGSLLSEYAHFSGNYLAECAPPVSAASTDIFPLPKISPAESPSMGSGEQALEPKHESAASRTSSWKLEA