Tfome Clone Information

TFome Information for pUT4754

TFome Name pUT4754
Template Synthesized template
Genbank Insert ID KJ727320
Protein Name ZmMYB86
Species Maize
TF Family MYB
Gene ID GRMZM2G027697
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGACGGCCAATTTGGTTGGGGTAGAGAAGAAGGCGGTTGGAGAAAGGGCCCATGGACTGCTCAAGAGGACAAGCTGCTGGTTGAGTACGTTAGGCAACATGGCGAAGGCCGCTGGAACTCTGTGGCTAAGCTTACTGGCCTTAAGAGGTCCGGCAAGTCTTGTAGGCTTCGCTGGGTGAACTACCTGAGGCCAGATTTGAAGAGGGGCAAGATCACCCCGCAAGAGGAATCTGTGATCCTGCAGCTTCATGCCCTTTGGGGCAACAGGTGGTCTACTATTGCTAGATCTCTGCCGGGCAGGACCGACAACGAGATCAAGAACTATTGGAGGACCCACTTCAAGAAGGCCAAGCCGAGCAAGAACGTTGAGAGAGCTAGGGCTAGATTCCTGAAGCAGAGGCGCGAGATGCAGTCTCAGCTTCTGCTTCTTCAGGGCCAGGATCAGCACAGGCAAGAAGAGGAACAGCCAGACCACGATGATGATGGTGCTTCAGAGGCTACTCCAGGCGTGCCATTGGAAGAGGAGGAAGAACAGCAGCAGCAACAGCACGAGGACCTGAGGATGATGCTCCAGCAGGACATGGACGACTTGCTGTTCCAGTTCTGCCCAATGGCTAGCTGCACCTCTTCTAGCTGCTTGCTTCCAGGTGGTGGCTCTTGCGCTTCTGTGGTTTCTGCATCTGCTAGCGAGGACGGTTCTTCTGGCGATCATCAATTGGATGGCGCTGCTACTTGGGGCTGGGGCTCTCTTTGGAACCTGGACGATGTGGTGGATGATGTTGATGGCGGCGCTTGGGATAGCTCCTTCAGCTTCCTTCAAGATCAGGGCCTCGCCTTCTAC
TFome clones do not contain stop codon at 3'end.
translation: MDGQFGWGREEGGWRKGPWTAQEDKLLVEYVRQHGEGRWNSVAKLTGLKRSGKSCRLRWVNYLRPDLKRGKITPQEESVILQLHALWGNRWSTIARSLPGRTDNEIKNYWRTHFKKAKPSKNVERARARFLKQRREMQSQLLLLQGQDQHRQEEEQPDHDDDGASEATPGVPLEEEEEQQQQQHEDLRMMLQQDMDDLLFQFCPMASCTSSSCLLPGGGSCASVVSASASEDGSSGDHQLDGAATWGWGSLWNLDDVVDDVDGGAWDSSFSFLQDQGLAFY