Tfome Clone Information

TFome Information for pUT4756

TFome Name pUT4756
Template Synthesized template
Genbank Insert ID KJ727322
Protein Name ZmMYB51
Species Maize
TF Family MYB
Gene ID GRMZM5G803355
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGAAAAGGAGAAGGAAAAGTCCAGGGCCAGGCCATCTAGAGGACATTGGAGGCCAGGTGAGGACGATAAGCTGAGGCAGCTGGTTGATAAGTACGGCCCGAGGAACTGGAACTCTATCGCTGAGTCTCTTGAGGGCAGGTCTGGCAAGTCTTGTAGGCTTAGATGGTTCAATCAGCTGGACCCGAGGATCAACAGGCGCCCATTCACTGTTGCTGAGGAAGAACTGCTGCTCAGGGCTCATAGAGCCCATGGTAACAGGTGGGCTATCATCAGCAGGCTTTTCCCAGGCAGGACCGACAACGCTGTGAAGAACCATTGGCACGTTGTGATGGCTAGAAGGCGCAGAAGGACTCTTGTTGGCGAGGCTGCTGCTATCGGCTCTGTTGTTGTTCCACCAAGGCACCAGTACTTCCACTTCGGCTCTTGTTCTCCGCCACCACCAACTAGATCTCTGTGCTTCGCTGTTCCAGCTGGCTTCGGTCCACTTGGTCTTTCTAGGCCAGCTGCTTCTTGCGGCGTTAGGAACTGCAACGTTCCAACTGCTGTGGCTCTGCTGGATGATGGCCACAGGCACGACATGTCTAAGGATCTGGGCGGCGACGATGATAACGGCGGTGATGCTCTTGCTAAGCGCAAGGACGTGCAATTCTTCGACTTCCTGGGCGTTGGCATC
TFome clones do not contain stop codon at 3'end.
translation: MEKEKEKSRARPSRGHWRPGEDDKLRQLVDKYGPRNWNSIAESLEGRSGKSCRLRWFNQLDPRINRRPFTVAEEELLLRAHRAHGNRWAIISRLFPGRTDNAVKNHWHVVMARRRRRTLVGEAAAIGSVVVPPRHQYFHFGSCSPPPPTRSLCFAVPAGFGPLGLSRPAASCGVRNCNVPTAVALLDDGHRHDMSKDLGGDDDNGGDALAKRKDVQFFDFLGVGI