Tfome Clone Information

TFome Information for pUT4757

TFome Name pUT4757
Template Synthesized template
Genbank Insert ID KJ727323
Protein Name ZmMYB16
Species Maize
TF Family MYB
Gene ID GRMZM2G015021
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGCAGAGCCCCATGTTGTGATAAGGCCTCTGTGAAGAAGGGACCTTGGAGCCCAGATGAGGACGCTAAGCTGAAGGCCTACATCGAGGAACATGGCACTGGCGGCAATTGGATCGCTCTGCCACATAAGATCGGCCTGAAGAGGTGCGGTAAGTCTTGTAGGCTTCGCTGGCTGAACTACCTGAGGCCGAATATCAAGCACGGCGACTTCACCGAGGAAGAGGAACACATCATCTGCAGCCTGTACATCAGCATCGGCTCCAGGTGGTCTATCATTGCTGCTCAACTTCCAGGCAGGACCGACAACGACATCAAGAACTACTGGAACACCAAGCTCAAGAAGAAGCTGCTGGGCAAGAGGGCTCCATCTAGAAGGGCTAGGACTAACCAGGACCCATGCTACCTTGCTGCTGGTGCTGCATCTAGCAGCAGCTCATCTTCAGCTGCTACCGCTACTCAGGCTCTGTCTGCTTCTGCTCTTGAGAGGATCCAGCTGCACATGAGGCTTCAAGGCATCTACGGTGCTCTTGCTTGCTCAGGCGGCAACGACGATTCTAATGCTGCTTTCGGTTCTGCCGCAGCTGCTCCACCACAATGGCCAAAGCTTGAGGCTCTGAGCCAGGCTAACAGGCTTTTGCCAGGTTCTCTGCCAGCTGACGCTATGGCTACTACTGTGTCTGTGCAGCCACACCCACAGCATCTGGTTGAGGTTGACCACCATCAGTCTCTTGCTGCCGCTGCTTTGGAGGGCGAGCAACAACTTTCATCTGCTGGCGAGGGCGGTTTCTTCGAGAGGCCTAAGGTTGACTTCTACAGCCCATCAGCTGAGGTTGCAGCGGCTGCTGCAGCTTCAGTTGAGATGAACTCAGTGGCCCCAATGGTGGTTGGTGGTTATGCAGGCGCAGCTGGTTTCGGCCCACAACATCACCATGACGAGCTGTACGACTTCCTGTACTCCAAGTACGGCTCTGTTGGCGGCCTTGCTCATGATGGCGGTCATGTTCCAACTCTCCCAGAGCTGCAATGTCCAGATGGCGCTGCTGCCGTTGTTGGTGCTGATGAGAAGTTCAGCGCTTGGACTGCAGCTGCCTGCGATTATGGTGCCGCCGCTGGTGGACATCAGATTCAGGGCAATTCTATCGTGGGCAGCTCCCTGCATGATTACGTTTTGGGCGGTTACGGCCAG
TFome clones do not contain stop codon at 3'end.
translation: MGRAPCCDKASVKKGPWSPDEDAKLKAYIEEHGTGGNWIALPHKIGLKRCGKSCRLRWLNYLRPNIKHGDFTEEEEHIICSLYISIGSRWSIIAAQLPGRTDNDIKNYWNTKLKKKLLGKRAPSRRARTNQDPCYLAAGAASSSSSSSAATATQALSASALERIQLHMRLQGIYGALACSGGNDDSNAAFGSAAAAPPQWPKLEALSQANRLLPGSLPADAMATTVSVQPHPQHLVEVDHHQSLAAAALEGEQQLSSAGEGGFFERPKVDFYSPSAEVAAAAAASVEMNSVAPMVVGGYAGAAGFGPQHHHDELYDFLYSKYGSVGGLAHDGGHVPTLPELQCPDGAAAVVGADEKFSAWTAAACDYGAAAGGHQIQGNSIVGSSLHDYVLGGYGQ