Tfome Clone Information

TFome Information for pUT4963

TFome Name pUT4963
Template Synthesized template
Genbank Insert ID KJ727406
Protein Name ZmMYB122
Species Maize
TF Family MYB
Gene ID GRMZM2G416652
transcript T02
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGACCGTGGTTGAGGCTGGCGAGGTGCTGAATCTTAAGGTTGGCGAGAACCCACTGCTTGAGGGCGAAGCTAAGACTGGCTACGTGAGCCCAGATGACCAAGATGGCGAGACTGCATCTGAGAAGCCATGCGGTGCTCCACAATTGAAGAAGGGACCTTGGTCCCCAGACGAGGACAAGCTGCTGAAGAATTACGTTGAGGCACACGGCGAGGGCAAGTGGAACAAGGTTCAGAGGAACTCTGGCCTGAACAGGTGCGGTAAGTCTTGCAGGCTTAGGTGGACCAACCACCTGAGGCCAGATCTCAAGAAGGGCCCGTTCGACAACGAGGAAATCGACAAGATCCTGAAGTTCTACCTGAAGTGGGGCCCGAAGTGGGCTAAGATCGCTTCTAGACTTCCAGGCAGGACCGATAACGAGATCAAGAACTTCTGGAACACCCGCATCAAGAAGACCGAGAAGCAGGGCCTTCCAATCTACCCAGAGCATGTGCTGTCTCAGGTGAAGCAGCCACAGCAGGACATGAACTGCGAGACTCCAGGCCTTTCTCACGGCAAGAAGAGGATCAGAGAGATCGAGATCCACGACCTGATGGACGTGAAGATCCTTTTCCAGCACCTGGACTACCACAAGGATCTGGTGGTGCCAACTAAGCCACTTAAGAGGCGCGCTTCTATCGGCAGCCTGAAGATCTCTGGGGAGACTAAGGAAACCTACTGCAGCACCGACCTGAACTACGTGTTGGCTAGGTCTGAGTCTGTGCCAACCGGCAGCGCTATTGCTTCTGGTTACCCAGTTGAGCTGCCGAGCATCCAGTCATCTAGCAGCACCCTGTCTAACGATTGGCTGCTCCAATGCGTGAGCGCTTCTGTTGAGCAGCAGATCCACAGCTCTATCCAGTCCACCGAGACTATCAGCTCTCAGACTACTGGCCTGCTGCACACCATGAGCGAGATCTCATTCGAGACTCTCATCCCGATGGTGTACCCGATGATCCACTCTTTCGGCTACAGCGAGCATGAGAGCAGCCCAAACACTGACATCCAGGCTGCTAACCTGAGCCTGGGCTCTGATGATGTGAGCCAGTACTACCAGGTGGCCAGCTTCTTCGATCCAGGCGTTCCAGATACTGAGCTGGGCGCTTCTTTCTTCAACGACACTCCTCCAGAGACTAGCTTCCTGAACCAGCAAAAGCAAGTGAGC
TFome clones do not contain stop codon at 3'end.
translation: MTVVEAGEVLNLKVGENPLLEGEAKTGYVSPDDQDGETASEKPCGAPQLKKGPWSPDEDKLLKNYVEAHGEGKWNKVQRNSGLNRCGKSCRLRWTNHLRPDLKKGPFDNEEIDKILKFYLKWGPKWAKIASRLPGRTDNEIKNFWNTRIKKTEKQGLPIYPEHVLSQVKQPQQDMNCETPGLSHGKKRIREIEIHDLMDVKILFQHLDYHKDLVVPTKPLKRRASIGSLKISGETKETYCSTDLNYVLARSESVPTGSAIASGYPVELPSIQSSSSTLSNDWLLQCVSASVEQQIHSSIQSTETISSQTTGLLHTMSEISFETLIPMVYPMIHSFGYSEHESSPNTDIQAANLSLGSDDVSQYYQVASFFDPGVPDTELGASFFNDTPPETSFLNQQKQVS