Tfome Clone Information

TFome Information for pUT5352

TFome Name pUT5352
Template BT033269.1
Genbank Insert ID KJ727493
Protein Name ZmbZIP123
Species Maize
TF Family bZIP
Gene ID GRMZM2G002075
transcript T01
Vector pENTR/D-TOPO
Note c.G571A p.E191K not present in template FlcDNA. (not in functional domain)
Request Information: Deposited to ABRC
5' Primer Name: B446_F 3' Primer Name: B446_R
5' Primer Tm (º C): 75.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGGACGAGCTGCTCCG 3' Primer Sequence: CCAGGGGGCCGTCAACG
PCR Condition: 40 sec 98°C 30x : 15 sec 98°C 30 sec 58&de
Nucleotide Sequence: ATGGACGAGCTGCTCCGGAGCATCTGGACCGCAGAGGAGACCCAGGCCAAGGCCTCCGCCTCTATCGCAGGAGCGAGCGCGGGGATGCCCCCCACGCCGATGCAGCGGCAGGGATCGTCGCTCACACTGCCCCGCATGCTCAGCACCAAGACGGTCGACGAGGCGTGGAGAAATCTCGTGCGCGACGAACCGCCGCAGGGGGCGGACGGCGGCGGACACCAGCCGCCCCACCGCCAGTCAACGCTCGGGGAGATGACTCTGGAGGAGTTCTTGGTCAGAGCTGGCGCGGTCAAGGAGAACCCCGCTTCTGCTCCTCCAGCGCCGCCACCCATGGTGCCGCCGCGGCCGGTACCTGTTGCCCCTAAAAGCTCCGCCTTTTTTGGGGATTTACCGGGTGCCGACGACGACGCAGCTACGGCAGCGGTAGGGTTTGCACCGGTCGGCATGGTGGATCTGGCCCTGATACCGCCCAGGGCGGCAGGCATGGGAGGCAGCGCCATGGCTGTGCAAACAGCGGTGAGCCAGCTTGATTCTGTCGGGAAGGGATACAGCGACCTGTCGTCGCTGACGAAGCCGCAAACTTTTTCGTTTGAAAGAATGATTCGGGGGAGAAGGCATGGAGGCGGAGTGGAGAAAGTGGTGGAGAGGCGGCGGCGGAGGATGATCAAGAACAGGGAGTCCGCCGCGAGGTCCCGAGCGCGCAAACAGGCTTATACAATGGAGTTAGAAGCCGAAGTTCAGAAACTCAGAGAGCAGAATCAGGAACTGGAGAGGAAACAGGCAGAAATTATGGAAATGCAGAACAACGAGGTATCAGAAATGTTGAAGGATCCATTCGGACGGAAGAAACGGCTGTGCTTGCGAAGAACGTTGACGGCCCCCTGG
TFome clones do not contain stop codon at 3'end.
translation: MDELLRSIWTAEETQAKASASIAGASAGMPPTPMQRQGSSLTLPRMLSTKTVDEAWRNLVRDEPPQGADGGGHQPPHRQSTLGEMTLEEFLVRAGAVKENPASAPPAPPPMVPPRPVPVAPKSSAFFGDLPGADDDAATAAVGFAPVGMVDLALIPPRAAGMGGSAMAVQTAVSQLDSVGKGYSDLSSLTKPQTFSFERMIRGRRHGGGVEKVVERRRRRMIKNRESAARSRARKQAYTMELEAEVQKLREQNQELERKQAEIMEMQNNEVSEMLKDPFGRKKRLCLRRTLTAPW