Tfome Clone Information

TFome Information for pUT5353

TFome Name pUT5353
Template BT063597.1
Genbank Insert ID KJ727494
Protein Name ZmMYB99
Species Maize
TF Family MYB
Gene ID GRMZM2G175232
transcript T01
Vector pENTR/D-TOPO
Note . c.C36T p.G12(=) c.G840A p.G240(=) c.G850A p.A284T Not present in template FlcDNA. Not in functional domain.
Request Information: Deposited to ABRC
5' Primer Name: C148_F 3' Primer Name: C148_R
5' Primer Tm (º C): 76.0 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGACGGCTCTCCTGC 3' Primer Sequence: GAAGTATTCCAAGCCGAAGTCGAG
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGGACGGCTCTCCTGCGGCGGCGGTGGCGGCGGTGGCGTGCAGCCCAAGCTCCGCAAGGGGCTCTGGTCGCCCGAGGAAGACGAGAAGCTGTACAATCACATCATCCGACACGGCGTCGGCTGCTGGAGCACTGTCCCCAAGCTCGCAGGGCTGCAGCGCTGCGGCAAGAGCTGCCGCCTGCGGTGGATCAACTACCTCCGCCCCGACCTCAAGCGCGGCAGCTTCTCGCAGCAGGAGGAGGACCTCATCGTCGCGCTCCACGAGATCCTGGGGAACAGGTGGTCGCAGATCGCGTCGCACTTGCCGGGGCGGACGGACAACGAGATCAAGAACTTCTGGAACAGCTGCCTGAAGAAGAAGCTCCGGCAGCGCGGCATCGACCCGGCCACGCACAAGCCAGTCGCCGCGGCGGAGGCGAGCGCGGCGCTGCCGGACGCTCGAGACCACGACCGTGAGCCCGGAGGAGCCGGCGCCGGCGCCGACGCCGACGGCCTGGCGCAGCAGAGCAAGCAGCCGGCGGCGGCCGTGTTCGACCCGTTCCCTGTGGTCGACTTCGGCTTCGACCTGAGCGGCGGCGGCGGCGTGGCGGCATTGTACGGCGGCCCGTACGACGCCGCCGCCGGCAAGGCGTCGGCGGACGACGGCGGGTTCGTGGCCGACTACAGCAGCGTGCTGGACGTGTCGGAGAACCTGGGATACGGGGAGAGCTCCAGCAACAGCAGCAACTGGGGGAACGGCGCGGAGATGGGCAATGCCGCCGCCGCCGTGCTCGACGGCGAGGTGCTGCACTGGGCCAAGCCGGAGCCGTACACGGAGCTGGAGCAGCGGAGCGCGGGACAAGCCGCCACGGACGACGACGCGCTGCATCATAGGTTCTTGCTGCCCTGCGGCCAGGAGCAGAGCCTGGCGCATCTCGACTTCGGCTTGGAATACTTC
TFome clones do not contain stop codon at 3'end.
translation: MGRLSCGGGGGGGVQPKLRKGLWSPEEDEKLYNHIIRHGVGCWSTVPKLAGLQRCGKSCRLRWINYLRPDLKRGSFSQQEEDLIVALHEILGNRWSQIASHLPGRTDNEIKNFWNSCLKKKLRQRGIDPATHKPVAAAEASAALPDARDHDREPGGAGAGADADGLAQQSKQPAAAVFDPFPVVDFGFDLSGGGGVAALYGGPYDAAAGKASADDGGFVADYSSVLDVSENLGYGESSSNSSNWGNGAEMGNAAAAVLDGEVLHWAKPEPYTELEQRSAGQAATDDDALHHRFLLPCGQEQSLAHLDFGLEYF