Tfome Clone Information

TFome Information for pUT5356

TFome Name pUT5356
Template BT038667
Genbank Insert ID KJ727497
Protein Name ZmMYB130
Species Maize
TF Family MYB
Gene ID GRMZM2G069325
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B306_F 3' Primer Name: B306_R
5' Primer Tm (º C): 70.4 3' Primer Tm (º C):
5' Primer Sequence: ccacATGGCGGCCAGTAGCAGCGGAGC 3' Primer Sequence: CGTCAGCCTGTTGCAGAGACCC
PCR Condition: PCR Reaction Mix:5 l GC buffer (NEB) 1 l primer fo
Nucleotide Sequence: ATGGCGGCCAGTAGCAGCGGAGCAGCCTTCGCGGCGCCCGCCACGCCGGCGCTCTCGCCCGCCTCCTCGTGCGTCACCAGCTCCTCCAGCGGCGACGTGCGCCTCGGCGCAGCGTACACGGAGCCGCCGCCGCCTCGGCAGCACGCGGGGCTCGTACGCTCTGACGCTCCGCGGACGGAGCTCGCGCCCGTGCCGGCAGTCGCGCACCTGGACGGCGCCTGCTGGCCGGCCGCGGCGGCGCTGGACGTGCTCCTGCCCGAGCTCGGCGGCGAGCAGCTGTTCCCGTACGGGTACGGCGACTTCTTCGGCGGGCTGCAGGACAGGGCCCTGGAGCAGCAGCTCTCGTCGTGCTACTTCCCCAACGTGGCCGAGATATGGGGCGCCGCTGCCGTCGCCCCCGACGGCAAGCCGCCGGGTCTCTGCAACAGGCTGACG
TFome clones do not contain stop codon at 3'end.
translation: MAASSSGAAFAAPATPALSPASSCVTSSSSGDVRLGAAYTEPPPPRQHAGLVRSDAPRTELAPVPAVAHLDGACWPAAAALDVLLPELGGEQLFPYGYGDFFGGLQDRALEQQLSSCYFPNVAEIWGAAAVAPDGKPPGLCNRLT