Tfome Clone Information

TFome Information for pUT5365

TFome Name pUT5365
Template BT063950.1
Genbank Insert ID KJ727506
Protein Name ZmMYB93
Species Maize
TF Family MYB
Gene ID GRMZM2G093660
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: C150_F 3' Primer Name: C150_R
5' Primer Tm (º C): 65.5 3' Primer Tm (º C):
5' Primer Sequence: caccATGGAGGGCGGCGATGG 3' Primer Sequence: GTCCTGGCCGTTCGCGGCACTACC
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGAGGGCGGCGATGGCTGCGGCTCCTCGGCGGCGGCGTCGGGGTCCGGGAGGGTGACGCGGCGGTGGACGCCGGAGGAGGACGACCTGCTGCGGCGCGCGGTCGCGCGGCACGGGCCGCGGAAGTGGCCCGAGCTCAGCGTCGATATCCCCGGTCGGTCCGGAAGGTCGTGCCACCGGCGGTGGGTCCAGCATCTCAGCCCCGGCCTGGAGCGTCGCGCCTTCACGCCCGAGGAGGACGCCGTCATCGTCGCGGCGCAAGCGATGTACGGCAACAAGTGGACCACCATCGCGCGGATGCTCCCCGGCCGCACCCGCACCGATATCTCCATCAAGAACCGCTGGAACTCCGCGCTGCAACAACATTGCAGGGCGGCGACCGCCAGCGCCAACACCGCCGGGTGCGCCCTCCCACTGCGGCCGGCGACCACGGCCCCCGTGCCGATTCCCGATCTCATGTATCTCAACAAGAAGTTGGCGGCGGCTGAGGCATCCCTTCCGTTCCCTCGTCTGGAGCCAAAGGACGACGAGGACGACGAGGACATGGACGAGACGGGCGAGGACGAGGACATGAACGAGCTGGGGGACGACGGCAGCAGCGAGGTCTTCCCGCCCGTGCCGGCGGTGCCGCTCACGCTAACCCTCAGCCTCTCTTCCGGCGTCCACGGCACCCTCGCATCGCAGAGCACCTTCGCATCTGCGGCGACCCTCGCATCGGCGGCTACCCTCGCATCGCAGAGCACCCTCGCATCGCAGAGCACCTTCGCATCGGCGGCGGCGACAGCGGGGAGTGCCATGACAATGAGGTCGAATCTTGGGCAGGATCCGTGGTTGGTGCCTGCGTTGCGGCTGATTGTTAGCGATGAGGTGCAGCGGAAGATGCAGGAGATGCCGCAGGTCACGGCTCCGGCCAGCAGGAGCAGCGCCGATGCTGCCGACGGTAGTGCCGCGAACGGCCAGGAC
TFome clones do not contain stop codon at 3'end.
translation: MEGGDGCGSSAAASGSGRVTRRWTPEEDDLLRRAVARHGPRKWPELSVDIPGRSGRSCHRRWVQHLSPGLERRAFTPEEDAVIVAAQAMYGNKWTTIARMLPGRTRTDISIKNRWNSALQQHCRAATASANTAGCALPLRPATTAPVPIPDLMYLNKKLAAAEASLPFPRLEPKDDEDDEDMDETGEDEDMNELGDDGSSEVFPPVPAVPLTLTLSLSSGVHGTLASQSTFASAATLASAATLASQSTLASQSTFASAAATAGSAMTMRSNLGQDPWLVPALRLIVSDEVQRKMQEMPQVTAPASRSSADAADGSAANGQD