Tfome Clone Information

TFome Information for pUT5383

TFome Name pUT5383
Template Genomic DNA
Genbank Insert ID KJ727524
Protein Name ZmMYB127
Species Maize
TF Family MYB
Gene ID GRMZM2G369799
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: SE0083_F 3' Primer Name: SE0083_R
5' Primer Tm (º C): 60.5 3' Primer Tm (º C):
5' Primer Sequence: caccATGATGAAGAACTACCCTGGTCC 3' Primer Sequence: ACGGTGGTGTCCCTTGGCTC
PCR Condition: Step 1, 98°C 3 min melt, 1 cycle; Step 2, 98&d
Nucleotide Sequence: ATGATGAAGAACTACCCTGGTCCTGCTAGCAGCAGTAGTGTTGCTGTAGAGGTGAAGAAGGGGTCATGGAGCCCCGAGGAGGACGCCCTGCTGACCAGGCTGGTGGAGCAGCACGGGCCCCACCGCTGGAGCCTCATCAGCGCCCCAATCCCTGGCCGCTCCGGCAAGTCCTGCCGACTCCGCTGGTGCAACCAGCTCAGCCCCGACGTGCACCACCGCCCTTTCACGCCGCACGAGGACGCGCTCATCCTCGCCGCTCACGCCCGCTACGGCAACAAGTGGGCCACCATCGCGCGCCTCCTTCCCGGCCGCACCGACAACTCCATCAAGAACCACTGGAACTCCAACCTCCGGAGGTGCAGGCGCCGAGCGGCGGCGGCGGCGGTGGCCTCCCGACCGCAGGTGCAGGACAGCGACGACGCTCCTGCTGCTGCTGCTGCTCATGATGATCAGCCGGCGGCTGTGGTTGCTGCTGGTGGTTTAGGTGGTGGCAACAGCAGCAGCGGTCTGCCGCCTGCAGCAGCAGGGGCCGCAACTGCCGAGGCCGAGCCGTCTCTGTCCCTCAGCCTTGGCCTCCCGCTGCCAGCAGCAGAACCAGCTGAAGCCGCGGCTGACGACGAGAGCCGCAACAGCCAGGGCCAGGCATCGCCGTTACTGGAGGAAGGAGAAGGAAACGCGCAGCTGTTGGCAGTGGTGCGCCGGATGGTCAGGGAGGAGGTGCAACGCCAGACGGGACAGCTCGCCTACTCGCTCATGGCCGCAGCAGCAGCCAGAGCCAAGGGACACCACCGT
TFome clones do not contain stop codon at 3'end.
translation: MMKNYPGPASSSSVAVEVKKGSWSPEEDALLTRLVEQHGPHRWSLISAPIPGRSGKSCRLRWCNQLSPDVHHRPFTPHEDALILAAHARYGNKWATIARLLPGRTDNSIKNHWNSNLRRCRRRAAAAAVASRPQVQDSDDAPAAAAAHDDQPAAVVAAGGLGGGNSSSGLPPAAAGAATAEAEPSLSLSLGLPLPAAEPAEAAADDESRNSQGQASPLLEEGEGNAQLLAVVRRMVREEVQRQTGQLAYSLMAAAAARAKGHHR