Tfome Clone Information

TFome Information for pUT5388

TFome Name pUT5388
Template EB402681
Genbank Insert ID KJ727528
Protein Name ZmMYB103
Species Maize
TF Family MYB
Gene ID GRMZM2G111045
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B278_F 3' Primer Name: B278_R
5' Primer Tm (º C): 69.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGAAGGGCACCCTGCTGCG 3' Primer Sequence: CTTGAAAGCCGAGTCCAGGGACG
PCR Condition: PCR Reaction Mix: 8.75l ultrapure water 2.5l 10x t
Nucleotide Sequence: ATGGGAAGGGCACCCTGCTGCGACAAGAACAAGGGCCTCAAGAAGGGGCCCTGGACGCCGGAGGAGGACAAGCTCCTCGTCGACTACATCCAGACCAACGGCCATGGCAGCTGGCGCCTGCTCCCCAAGCTCGCAGGGCTGAACCGGTGCGGCAAGAGCTGCCGACTGCGGTGGACCAACTACCTCCGGCCGGACATCAAGCGCGGGCCCTTCACAGCCGAGGAGGAGAAGTCCATCGTCCAGCTCCACGCCATCGTCGGCAACAAGTGGTCCATGATCGCGGCGCAGCTCCCAGGCCGGACGGACAACGAGATCAAGAACTACTGGAACACGCACCTCAAGAAGCAGCTGCGCCGGATGGGCCTCGACGAGCCCCCGCCCGGCCCGGCCGCCGGCTGCCCCGCCGCGCGCCACATGGCGCAGTGGGAGACGGCCAGGCTCGAGGCCGAGGCGCGCCTCTCCCTCCTCGCCGCCACCGCCGCCTCCTCCGGCACCACCGCGACCACCACAGCCACCACCACCACGTCTGCAGCCTCCTCGTCCTCCACCACCGTCGCTGGCGCGGCCGACAACAAGGCCTCCAACCCCGCGGACATCTTCCTGCGCCTGTGGAGCTCGGACATCGGGGACTCCTTCCGCCGCAAGACGGACACGACGCCAGCGGTGCCCGCGCTTCCGGCGCCCGTCGTCAAGAGGAAGGACACGGCGATCAAGCAGGAGCCGCGGGCGCTGCTGCTCGGCCTCAGGGACGACTCCTCGGCGGCGTCCAACGACAACGAGACGGAGGTGGCGGAGGCGCTGGAGGCGAAGTACCAGATGTTCCTCGACTTCGCGGGCGAAGAGCTGGGATTGTTCCATGGCCGGCACGGCGGCTTCTCGCTGTTCCCGCCGCTCGACGTGCTCGCTGAGGCGTCCCTGGACTCGGCTTTCAAG
TFome clones do not contain stop codon at 3'end.
translation: MGRAPCCDKNKGLKKGPWTPEEDKLLVDYIQTNGHGSWRLLPKLAGLNRCGKSCRLRWTNYLRPDIKRGPFTAEEEKSIVQLHAIVGNKWSMIAAQLPGRTDNEIKNYWNTHLKKQLRRMGLDEPPPGPAAGCPAARHMAQWETARLEAEARLSLLAATAASSGTTATTTATTTTSAASSSSTTVAGAADNKASNPADIFLRLWSSDIGDSFRRKTDTTPAVPALPAPVVKRKDTAIKQEPRALLLGLRDDSSAASNDNETEVAEALEAKYQMFLDFAGEELGLFHGRHGGFSLFPPLDVLAEASLDSAFK