Tfome Clone Information

TFome Information for pUT5389

TFome Name pUT5389
Template BT034900.1
Genbank Insert ID KJ727529
Protein Name ZmMYB34
Species Maize
TF Family MYB
Gene ID GRMZM2G125522
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B280_F 3' Primer Name: B280_R
5' Primer Tm (º C): 63.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGATGGCGGAGGCGTG 3' Primer Sequence: CAACTGTCCGCAGTGCATCAGG
PCR Condition: PCR Reaction Mix: 5 l GC buffer 1 l primer forward
Nucleotide Sequence: ATGATGGCGGAGGCGTGGACGCCGGTGCCGTTCCCGCCGACGGCGCCCTGCTTCTGGCTGCACGACACGCACTCGGTTTTCTGGCGGGGAGGAGACGCGTGGACGGCGGCGGAGAACAAACTGTTCGAGAAGGCGCTGGCGCAGATCGACCGTAACGCGCCCGACAGGTGGGAGAAGGTGGCGGAGGTGGTGCGCACGAAGACGGTCGACGACGTGAGGAACCACTACCACGACCTGGAGAACGACGTCGGCTTCATCGAGGCCGGGCTCGTGCCGTTCCCGCACTACAGCGGCTCGGTTCCGTCGTTCGGGTTCACCCACGAGGATTGGGACGGAGGGTTCAGGCGCGGCTACTGCCTTAAGCGCGCGCGCGGCTCCGACCCGGAGCGGAAGAAGGGCGTCCCCTGGACGGAGGAGGAGCACAAGCTTTTCTTGATGGGACTGAAGAAGTACGGGAGAGGGGACTGGAGGAACATCTCGCGCAAGTACGTGACGACCCGGACGCCGACGCAGGTGGCCAGCCACGCGCAGAAGTACTTCATCCGCCTCAACTCCGGCGGCAAGGACAAGCGCCGGTCCAGCATCCACGACATCACCACCGTCAACCTCCCCGACGAAGACCGCGGCAACGCGCCGCCGTCCGCGGTCACCACCACCACCAACCCCTCCGTCGCCCTCGTGGACATGAAGCCCTTCGTTGCGCCGTCGCTCGGCGTGCCGCACCCCTACGGCGACGTGAAGCTGGAGCCTAAGAGCTCGCTGGTGGCCGGCCTGGGCTTCAACGACTCCGTCCTCCTGATGCACTGCGGACAGTTG
TFome clones do not contain stop codon at 3'end.
translation: MMAEAWTPVPFPPTAPCFWLHDTHSVFWRGGDAWTAAENKLFEKALAQIDRNAPDRWEKVAEVVRTKTVDDVRNHYHDLENDVGFIEAGLVPFPHYSGSVPSFGFTHEDWDGGFRRGYCLKRARGSDPERKKGVPWTEEEHKLFLMGLKKYGRGDWRNISRKYVTTRTPTQVASHAQKYFIRLNSGGKDKRRSSIHDITTVNLPDEDRGNAPPSAVTTTTNPSVALVDMKPFVAPSLGVPHPYGDVKLEPKSSLVAGLGFNDSVLLMHCGQL