Tfome Clone Information

TFome Information for pUT5390

TFome Name pUT5390
Template DR807137
Genbank Insert ID KJ727530
Protein Name ZmMYB11
Species Maize
TF Family MYB
Gene ID GRMZM2G000818
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B283_F 3' Primer Name: B283_R
5' Primer Tm (º C): 67.9 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGAGGTCGCCGTGCT 3' Primer Sequence: TTTCATCTCGAGTCTTCTG
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGGGAGGTCGCCGTGCTGCGAGAAGGCGCACACGAACAAGGGCGCGTGGACCAAGGAGGAGGACGACCGTCTGGTGGCGTACATCAAGGCGCACGGCGAGGGGTGCTGGCGCTCCCTTCCCAAGGCCGCCGGACTTGTGCGCTGCGGCAAGAGCTGCCGCCTCCGGTGGATCAACTACCTGCGGCCCGACCTCAAGCGCGGCAACTTCACGGAGGAGGAGGACGAGCTCATCATCAAGCTCCACAGCCTACTCGGCAACAAATGGTCCCTGATCGCTGGAAGGCTGCCGGGCAGGACCGACAACGAGATCAAGAACTACTGGAACACGCACATCCGGCGGAAGCTGCTGAGCAGGGGGATCGACCCGGTGACACACCGCCCCATCAACGAGCACACGTCCAACATAACCATATCGTTCGAGGACTGGGGCCAGGGGAAGGCGCTCAAGTGCCCCGACCTGAACCTGGACCTCTGCATCAGCCCGCCGTGCCAGGAGGAGGAGGAGGCCATGCTGCTGAGGCCGGTGAAGCGGGAGGAGGCCGGGCTCTGCTTCAGCTGCAGCCTGGGGCTCCCCAAGAGCGCGGACTGCAAGTGCAGCAACTTCCTCGGGCTCAGGACCGCCATGCTCGACTTCAGAAGACTCGAGATGAAA
TFome clones do not contain stop codon at 3'end.
translation: MGRSPCCEKAHTNKGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLVRCGKSCRLRWINYLRPDLKRGNFTEEEDELIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHIRRKLLSRGIDPVTHRPINEHTSNITISFEDWGQGKALKCPDLNLDLCISPPCQEEEEAMLLRPVKREEAGLCFSCSLGLPKSADCKCSNFLGLRTAMLDFRRLEMK