Tfome Clone Information

TFome Information for pUT5391

TFome Name pUT5391
Template DR968120
Genbank Insert ID KJ727531
Protein Name ZmMYB112
Species Maize
TF Family MYB
Gene ID GRMZM5G803308
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B291_F 3' Primer Name: B291_R
5' Primer Tm (º C): 66.6 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGCTCGGAGGCGGA 3' Primer Sequence: CTGCATCCGGCCGACCCG
PCR Condition: PCR Reaction Mix: 8.75l ultrapure water 2.5l 10x t
Nucleotide Sequence: ATGGGCTCGGAGGCGGACTGCGACAGGATCAGGGGCCCGTGGAGCCCCGAGGAGGACGACGCGCTGCGGCGGCTCGTGGAGCGGCACGGCGCGCGCAACTGGACGGCGATCGGGCGCGAGATCCCGGGGCGGTCGGGCAAGTCGTGCCGCCTGCGGTGGTGCAACCAGCTGTCGCCGCAGGTGGAGCGCCGGCCCTTCACGGCGGAGGAGGACGCGGCCATCGTCCGCGCCCACGCCCGCCTCGGCAACCGCTGGGCCGCCATCGCGCGCCTCCTCCCCGGCCGCACCGACAACGCCGTCAAGAACCACTGGAACTGCTCGCTCAAGCGCAAGCTCGCCGCCGCGTCCGCCCCGGCGGGTTCCTCCGACGTCGAGGCGCGCCCGACCAAGCGCGTCAGCCTCTCGCCCGACAGCCCGTCGGGGTCGGGGTCGGGGTCAGGGTCAGGGTCCGGGTCCGGGTCCGGGTCCGACCGTAGCGACCTGAGCCACGGCGCCGGCCAGGTTTACCGCCCAGTGGCGCGGTCCGGCGGGTTCGAGCCGGCGGACTGCGCGATGAGCCGTCCGCTGGAGGAAGAGGAGGAGGAAAAGGAGGACCCGCTCACCTCCCTCAGCCTCTCGCTTCCAGGCACGGACCAGCGGTTCCACCACGACCGCGCCCACAGCCAGTTCCAGGAGCTCCCGGCGTCGCCGCCCTCGCCCTCCCCGCCTCCGCCGCCGGTTCTCTCGGCGTACCCGTTCAGCCCCGTGTTCATGGAGGCGATGCAGGAGCTGATCCGCACGGAGGTGCAGCGGTACATGGCGAGCGTGGGCGTGCGCGCCGGGTGCGGCGCCGCCGGCGGGGCCGACCTCTGCATGCCGCAACTGGTCGACGGCGTCATGCGCGCCGCCGCCGAGCGGGTCGGCCGGATGCAG
TFome clones do not contain stop codon at 3'end.
translation: MGSEADCDRIRGPWSPEEDDALRRLVERHGARNWTAIGREIPGRSGKSCRLRWCNQLSPQVERRPFTAEEDAAIVRAHARLGNRWAAIARLLPGRTDNAVKNHWNCSLKRKLAAASAPAGSSDVEARPTKRVSLSPDSPSGSGSGSGSGSGSGSGSDRSDLSHGAGQVYRPVARSGGFEPADCAMSRPLEEEEEEKEDPLTSLSLSLPGTDQRFHHDRAHSQFQELPASPPSPSPPPPPVLSAYPFSPVFMEAMQELIRTEVQRYMASVGVRAGCGAAGGADLCMPQLVDGVMRAAAERVGRMQ