Tfome Clone Information

TFome Information for pUT5392

TFome Name pUT5392
Template BT042537.1
Genbank Insert ID KJ727532
Protein Name ZmMYB129
Species Maize
TF Family MYB
Gene ID GRMZM2G070523
transcript T02
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B309_F 3' Primer Name: B309_R
5' Primer Tm (º C): 69.5 3' Primer Tm (º C):
5' Primer Sequence: caccATGGAGAAGAGCCCGGGCGCC 3' Primer Sequence: CTCACCTCCGCCACCATGCCACTCCA
PCR Condition: PCR Reaction Mix:5 l GC buffer (NEB) 0,5 l primer
Nucleotide Sequence: ATGGAGAAGAGCCCGGGCGCCGCGCCGACATCATCGCCCGAGGAGGAGGTGGCGGCGGATGGCCGCGGGCACGTTGAGGACGCGACGGGGCAGAAGGAGCAGGCGACGCCGGTGGTGCTCAAGAAGGGGCCGTGGACGGCAGCGGAGGATGCCATGCTCATGGACCACGTCCGGCACCACGGCGAGGGGAACTGGAACGCAGTGCAGAGGGTGACCGGCCTGCTGCGCTGCGGCAAGAGCTGCCGCCTGCGCTGGACCAACCACCTCCGCCCCAACCTCAAGAAGGGCTCCTTCTCCCCCGACGAGGAGCTCCTCATCGCCCAGCTCCACGCGCAGCTCGGCAACAAGTGGGCGCGCATGGCCGCGCATCTGCCGGGGAGGACGGACAACGAGATCAAGAACTACTGGAACACGAGGACCAAGCGCCGCCAGCGCGCCGGCCTGCCTGTGCACCCGCCGCCAGAGGTGCAGCTCCAGCTCGCCCTCGCCAGGCGCTGCCGCTACGACGACTTCTCGCCGCTGCCGTCCCCGCAGGAGCTGTCCGGTGTCCAGGCGCTGGTGGGCGCCGCCGCCTCGGCCGGGTACGCCAGCTCCCGCCCGGCGCCCCTCGACCTGGCTCGGCAGCTCACCCAGACGACGAACCAGCAGACGGAGACTGTGCAGTTCCTCTCGCCGCCACCCTTCTCGGCGCCGTCGTCCCCGTGGGCGAGGCCGTTCGCCCGGAACGCGCAGTACTTCCAGCTCGCGCACTCGTCGTCGCCCGTGTCCCCGACGACGCCGGACCTGTCCCTCGGCTACGGCGCGCGCAGCGCCGGCGCCGACCAGAGCAGGCTCCCGCCGCTCTCGCCGTCCCCTTGCCCCAGAGTGGTGGAGCTCCCTTCAAACCAATACGCCCAACCGACGCCGCCGGCCTCGGCCGCCGCCACCGCACTTGGAGGTGGTGGCGCAGCGCTGCCGGATCATCAGAACGCGGCGAGCCTCGAGAAGATGCTGCGCGAGCTGCATGACGTCATCAAGGTCGACCCGCCGGCGCTGGTCCCGGCCAGCGGCGGCGCTGCCCTGGAGTGGCATGGTGGCGGAGGTGAG
TFome clones do not contain stop codon at 3'end.
translation: MEKSPGAAPTSSPEEEVAADGRGHVEDATGQKEQATPVVLKKGPWTAAEDAMLMDHVRHHGEGNWNAVQRVTGLLRCGKSCRLRWTNHLRPNLKKGSFSPDEELLIAQLHAQLGNKWARMAAHLPGRTDNEIKNYWNTRTKRRQRAGLPVHPPPEVQLQLALARRCRYDDFSPLPSPQELSGVQALVGAAASAGYASSRPAPLDLARQLTQTTNQQTETVQFLSPPPFSAPSSPWARPFARNAQYFQLAHSSSPVSPTTPDLSLGYGARSAGADQSRLPPLSPSPCPRVVELPSNQYAQPTPPASAAATALGGGGAALPDHQNAASLEKMLRELHDVIKVDPPALVPASGGAALEWHGGGGE