Tfome Clone Information

TFome Information for pUT5438

TFome Name pUT5438
Template BT039321
Genbank Insert ID KJ727578
Protein Name ZmMYB84
Species Maize
TF Family MYB
Gene ID GRMZM2G173633
transcript T01
Vector pENTR/SD/D-TOPO
Note c.C187T p.P63S In between two Myb-domains. Present in template FLcDNA.
Request Information: Deposited to ABRC
5' Primer Name: C142_F 3' Primer Name: C142_R
5' Primer Tm (º C): 67.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGCGGATCCCGTGC 3' Primer Sequence: CACCATGTGATTGGTCAGCTCGTCG
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGGGCGGATCCCGTGCTGCGAGAAGGACAGCGTCAAGCGCGGGCAGTGGACGCCCGAGGAGGACAACAAGCTGCTCTCCTACATCACCCAGTACGGCACGCGCAACTGGCGCCTCATCCCCAAGAATGCCGGACTGCAGCGATGCGGGAAGAGCTGCCGGCTCCGGTGGACCAACTACCTGCGTTCCGACCTCAAGCACGGTGAGTTCACGGACACCGAGGAGCAGACCATCATCAAGCTGCACTCCGTCGTTGGCAACAGGTGGTCGGTGATCGCGGCGCAGCTGCCGGGTCGGACGGACAACGACGTCAAGAACCACTGGAACACCAAGCTGAAGAAGAAGCTGTCCGGGATGGGCATCGACCCCATCACGCACAAGTCCTTCTCGCACCTCATGGCCGAGATCGCCACCACGCTGGCGCCGCCGCAGGTGGCCCACCTCGCCGAGGCCGCGCTGGGGTGCTTCAAGGACGAGATGCTCCACCTCCTCACCAAGAAGCGCCCCACCGACTTCCCGTCGCCCGCGGTGCCCGACATGTCGGCGATCGCGGGCGGCTCCGGCGTCGCGGCGCCCTGCGGCTTCCCGGCGCCGCCCCAGACCGACGACACCATCGAGCGCATCAAGCTGGGCCTGTCCCGCGCCATCATGAGCGAGCCCGCCGCGCCCCCCGGCAAGCAGGAGCAGCCCTGGGCGCCGGCCGACTTGCCGGAGGGGCTGCCGGGGATGTACGCCACGTACAATCCCGCCTCGCACGGACACGAAGAGTTCCGCTACGACAACGGGACAGTGCCGGAGTACGTCCTCGGCGGCGGCGGCGGCGCGGACCAGGGCACGTCGATGTGGAGCCACCAGAGCATGTACAGCGGGAGTTCGGCCACGGAGGCCGCGCCCAGGCCGGCGGAGGTGTTGCCGGAGAAAGGCAACGACAGCGTCGGGAGCAGCGGCGGCGGCGAGGAGGCGGACGACGTCAAGGACGGCGGGAAAGGCGGCTCCGATATGTCCGGCCTGTTTGGATCCGACTGCGTACTTTGGGACTTGCCCGACGAGCTGACCAATCACATGGTG
TFome clones do not contain stop codon at 3'end.
translation: MGRIPCCEKDSVKRGQWTPEEDNKLLSYITQYGTRNWRLIPKNAGLQRCGKSCRLRWTNYLRSDLKHGEFTDTEEQTIIKLHSVVGNRWSVIAAQLPGRTDNDVKNHWNTKLKKKLSGMGIDPITHKSFSHLMAEIATTLAPPQVAHLAEAALGCFKDEMLHLLTKKRPTDFPSPAVPDMSAIAGGSGVAAPCGFPAPPQTDDTIERIKLGLSRAIMSEPAAPPGKQEQPWAPADLPEGLPGMYATYNPASHGHEEFRYDNGTVPEYVLGGGGGADQGTSMWSHQSMYSGSSATEAAPRPAEVLPEKGNDSVGSSGGGEEADDVKDGGKGGSDMSGLFGSDCVLWDLPDELTNHMV