Tfome Clone Information

TFome Information for pUT5565

TFome Name pUT5565
Template BT069744.1
Genbank Insert ID KJ727638
Protein Name ZmMYB100
Species Maize
TF Family MYB
Gene ID GRMZM2G143046
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B303_F 3' Primer Name: B303_R
5' Primer Tm (º C): 68.4 3' Primer Tm (º C):
5' Primer Sequence: caccATGGCCACGACACAGA 3' Primer Sequence: TTGCATCTTCCAAATTTCCTCCA
PCR Condition: PCR Reaction Mix: Volumes per reaction (25l): 5 l
Nucleotide Sequence: ATGGCCACGACACAGAGCTGTCAGAGCAGGAGCAGCGCCTGCAGCAAGGCTGCTGCTTGCTTCCCGGCCGCCGTAGCGGTCGACGAGGAGCACGGCCACCACAGCCACCAGCTGAAGGGAGGAGCGCAGGAGGAGGCTGAGAACGACAATAATAAGCCGGAGCTCCGGCGTGGCCCCTGGACGGTAGACGAGGACCTCACCCTCGTCAACTACATCGCCGACAACGGCGAGGGTCGCTGGAACAACCTCGCCCGCGCCGCCGGGCTGAAGCGGACGGGCAAGAGCTGCCGGCTGCGGTGGCTCAACTACCTCCGGCCCGACGTGAAGCGTGGCAACTTCAGCGCCGACGAGCAGCTGCTCATCCTCGACCTCCACACCCGCTGGGGCAACCGATGGTCGAAGATAGCGCAGCACCTGCCGGGAAGGACGGACAACGAGATCAAGAACTACTGGAGGACCCGGGTGCAGAAGCACGCCAAGCAGCTCAACTGCGACGCCAACAGCAAGCGCTTCAAGGACGCCATGCGCTACCTCTGGATGCCGCACCTCGCCGACGACGTCGATACCATCGCTGCGGCCAACGACGACGACGAAGACCACCACCACCACCTACGCCTCCTCGTCCTGCACCACCACCAGGCCCAGCACCTGCAGCAAGCTGCTGCCGCGGCCGGCGGCGCTGCCAACGACCTTGCTGCGGGCGCCTACGACGTCCGCCAGCTGCACGCGCTGCCGTCGTCGGGCATGGCGGCGACGTCGTCGTCCGACTCGCTCGCGTCGGAGTCGTACGATGACGGAGGCCTGCTTTTCGCGAACTTGCGCGCCGGCGAGATGCTGATGGACGGCGGAGATTGGGCGGCGCAGCAGGAGGCCGACCAAGGGCTGTGGCCGCCGCCGCCGCCGCCGCCGTCTGATCTTGATCAGTCGGTGGTGCAGGCTGCTGGTGCCGGCGCTGGCCAGTTTCAGGACATGGAGCTCAGTGGTTGGGTGCAAGGCTTCTCCGAGAGCATTACAGATAACTTTTGGGCCTTGGAGGAAATTTGGAAGATGCAA
TFome clones do not contain stop codon at 3'end.
translation: MATTQSCQSRSSACSKAAACFPAAVAVDEEHGHHSHQLKGGAQEEAENDNNKPELRRGPWTVDEDLTLVNYIADNGEGRWNNLARAAGLKRTGKSCRLRWLNYLRPDVKRGNFSADEQLLILDLHTRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQLNCDANSKRFKDAMRYLWMPHLADDVDTIAAANDDDEDHHHHLRLLVLHHHQAQHLQQAAAAAGGAANDLAAGAYDVRQLHALPSSGMAATSSSDSLASESYDDGGLLFANLRAGEMLMDGGDWAAQQEADQGLWPPPPPPPSDLDQSVVQAAGAGAGQFQDMELSGWVQGFSESITDNFWALEEIWKMQ