Tfome Clone Information

TFome Information for pUT5593

TFome Name pUT5593
Template Genomic DNA
Genbank Insert ID KJ727666
Protein Name ZmMYB90
Species Maize
TF Family MYB
Gene ID GRMZM2G047600
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: SE0029_F 3' Primer Name: SE0029_R
5' Primer Tm (º C): 63.2 3' Primer Tm (º C):
5' Primer Sequence: caccATGGCCGTGCTGTGGAAG 3' Primer Sequence: GTAGAGCGGTTGCTCCCAGATGT
PCR Condition: Step 1, 98°C 3 min melt, 1 cycle; Step 2, 98&d
Nucleotide Sequence: ATGGCCGTGCTGTGGAAGGGTTCGTCGTCTTCGCCCTGTGACTGGCCGGAGGCGACGGTGACCACCGTCAGCGACGCCGACGACGACGCGGCGGCGGCGGCGGAGCTGCGGCGGGGGCCGTGGACGGTGGAGGAGGACGCGGTCCTGGCGGGCCACGTGGCCGCGCACGGCGAGGGGCGGTGGAACGAGCTGGCGTGCGCCGCGGGGCTCAGGCGCACCGGCAAGAGCTGCCGCCTGCGCTGGCTCAACTACCTCCGCCCCGGCGTGCGCCGCGGGGGCTTCACCCCGCGGGAGCAGCTGCTCGTCCTCGACCTCCACTCCCGCTGGGGCAACCGCTGGTCCAGGATCGCCGCGCACCTGCCGGGCCGCACGGATAACGAGGTCAAGAACTACTGGCGCACGCGGGTGCAGAAGCACGCCAGGCAGCTGGGCTGCGCCGTCGGCAGCCGCCAGTTCAACGACGCCGTGAGGAACCTCTGGGTGCCGCGCCTGCTCGAGAGGATCCACGCCGACGACTCAGCAGCAGCAGCCGCCGCCGATGCCGATGCCGATGCCTCTCGCTGCTGCTACTCCGCGAGCCCATCGCACGATGAGCTGTCGTCGTCCCACCCGGCGCACCGAAACGCTGCGCCCATCACGGGCGACGACTGCGCGCGCGCACCGTCCCCGGACGTGTCCAGTGTCGTCACTGGGTCCTCGTGGTCACGGGAGGCGTCCCCCACGTCGCAGTTGTTCAAGTCGAGCAGTTCGACCGTGGAGGGATGCTCTACTTCTACCGAGACCGAGCAGTGCCAGAACGGATGCTCCTCGAGCGCGACGAGCGTTGACATGTTCGACGAGAGCTGGTCGGAGCTTCTTGCTCGCGCCATCCATGACGACGACGCGGAATTCGGATCGGGAGAAACCGGAGACAGCTGGTGGAGTTTGGAGGACATCTGGGAGCAACCGCTCTAC
TFome clones do not contain stop codon at 3'end.
translation: MAVLWKGSSSSPCDWPEATVTTVSDADDDAAAAAELRRGPWTVEEDAVLAGHVAAHGEGRWNELACAAGLRRTGKSCRLRWLNYLRPGVRRGGFTPREQLLVLDLHSRWGNRWSRIAAHLPGRTDNEVKNYWRTRVQKHARQLGCAVGSRQFNDAVRNLWVPRLLERIHADDSAAAAAADADADASRCCYSASPSHDELSSSHPAHRNAAPITGDDCARAPSPDVSSVVTGSSWSREASPTSQLFKSSSSTVEGCSTSTETEQCQNGCSSSATSVDMFDESWSELLARAIHDDDAEFGSGETGDSWWSLEDIWEQPLY