Tfome Clone Information

TFome Information for pUT5650

TFome Name pUT5650
Template Genomic DNA
Genbank Insert ID KJ727711
Protein Name ZmMYB101
Species Maize
TF Family MYB
Gene ID GRMZM2G425427
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: SE0089_F 3' Primer Name: SE0089_R
5' Primer Tm (º C): 61.2 3' Primer Tm (º C):
5' Primer Sequence: caccATGGATATGGACATGGACATGGC 3' Primer Sequence: GCTGCATGCGTGGTGATGATGAT
PCR Condition: Step 1, 98°C 3 min melt, 1 cycle; Step 2, 98&d
Nucleotide Sequence: ATGGATATGGACATGGACATGGCCATGGCCATGGTGGGCTTCGATGAGGACATGGACCAGGTGCTGGCGGCCATGAGCCCCGCCGGGAGCTCCGCGACGTCGTCCGCGCCCACCGCCGCCGCCGCTCCACCAGCCGTCGTCGCAGCAGGCAGCAGCGACGACGACGAGGCCGGCGCCGCCGACCTCCGGAGGGGCCCCTGGACGGCGGAGGAGGACATCCTCCTCGTCAACTACATCGCCGCCCACGGCGAGGGCCGGTGGAACTCGCTCGCCCTCTCCGCGGGCCTGAAGCGCACCGGCAAGAGCTGCCGCCTGCGGTGGCTCAATTACCTGCGGCCCAACGTGCGGCGGGGCAACATCACCGCCGAGGAGCAGCTGCTGATCCTGGACCTGCACTCGCGCTGGGGCAACCGGTGGTCCAAGATCGCGCAGCACCTTCCTGGGCGCACCGACAACGAGATCAAGAACTACTGGCGCACCCGCGTGCAGAAGCACGCCAAACAACTCCGCTGCGACGTCAACAGCGCCCACTTCCGCCACATCGTGCGCCACGTCTGGATGCCGCGCCTCCTGGAGCGCGCCCAGGCCGACGCCAGATGCGGCGGCGTACAGGCTCCGGCCACCACCACGGCCAGCGCGCCGCCCGCGTGTTATAACTACTACGACGACGGCCGCCAACACTTGCTGCAGCAACAGGGAAGCGCCCACCACGGCGTGCCGGCGGCGAGCGAAGCTCACCACCACCACCAATACTACAGCGAGCCGGCAGGCCCGACGGCGGCGACGGCCACGGCCCTGAGCCCCGACGACGCGTCCAGCGCGCTGCGGCCGTCGTCGTCGCTCACGGCGGACGACGCGTCGCATTATGCTGCAGCTTACGCTTACACCTCGGCGGCCACGGCGACCCCGACGACAGACGACCAACAAGGCGTCCTGCACCACTGCGGCGCCGATGCAAGAACCGGGCCAACGCCGAGTGACGCCGCCGGTGACGACGACGTGTTTGCCGGGACGACTTGGTCAGAGCTTCTCGCCACCACCGCTACCGGCGGCCCTCACGAGGACTGCAGCTCCATGTCCATGATCGGCCTGCAGCTGCAGGACTTTGGGATAGGGTATTTCGAGGGCGGCCTCTGGAGCCTGGACGACCTTAGCTTAGAGCAGCCGTGCACGCTGAGCTCACCTGCTGATGCATATCATCATCACCACGCATGCAGC
TFome clones do not contain stop codon at 3'end.
translation: MDMDMDMAMAMVGFDEDMDQVLAAMSPAGSSATSSAPTAAAAPPAVVAAGSSDDDEAGAADLRRGPWTAEEDILLVNYIAAHGEGRWNSLALSAGLKRTGKSCRLRWLNYLRPNVRRGNITAEEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQLRCDVNSAHFRHIVRHVWMPRLLERAQADARCGGVQAPATTTASAPPACYNYYDDGRQHLLQQQGSAHHGVPAASEAHHHHQYYSEPAGPTAATATALSPDDASSALRPSSSLTADDASHYAAAYAYTSAATATPTTDDQQGVLHHCGADARTGPTPSDAAGDDDVFAGTTWSELLATTATGGPHEDCSSMSMIGLQLQDFGIGYFEGGLWSLDDLSLEQPCTLSSPADAYHHHHACS