Tfome Clone Information

TFome Information for pUT5678

TFome Name pUT5678
Template BT087286.1
Genbank Insert ID KJ727737
Protein Name ZmMYB56
Species Maize
TF Family MYB
Gene ID GRMZM2G130149
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B282_F 3' Primer Name: B282_R
5' Primer Tm (º C): 65.1 3' Primer Tm (º C):
5' Primer Sequence: caccATGGTGACAGTGAGAGAGG 3' Primer Sequence: GAAGCAGGGCCCAACTCC
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGTGACAGTGAGAGAGGAGACTCGCAAGGGGCCATGGACAGAGCAGGAGGACCTGCAACTGGTATGCACTGTCCGTCTGTTCGGTGAACGTCGTTGGGATTTCATTGCCAAAGTATCAGGGCTCAACCGGACAGGCAAGAGCTGCCGGCTGCGCTGGGTCAACTACCTCCACCCTGGCCTCAAGCGTGGGCGCATGTCTCCCCATGAAGAGCGACTCATCCTAGAGCTGCACGCTCGGTGGGGAAACAGGTGGTCCAGGATAGCACGCCGCTTGCCAGGGCGCACTGACAATGAGATCAAGAACTACTGGAGGACACACATGAGAAAGAAGGCACAGGAGAGGAAGAGGAACATGTCTCCATCGTCGTCCTCGTCTTCGCTGACTTACCAGTCAGGCTACCCAGATACTCCATCAACCATTGGAGTTGAGGGACAGGAGCTTCATGGTGGCAGTGGCTGCATCACAAGCATCCTGAAGGGCACCCCTCCGGACATGGATGGCTATCCCATGGACCAGATATGGATGGAAATTGAGGCGCCACAGATGCCCTCGGAGGAGAGCTTTGTTGGGGGGAACCATAATGTGTGCAGCAGCCTTGCCACCCCGCTGCCACCACCAACTGTCTGGGAATACTACCCAGATGCCTGCTGGAAGGTTGACGATGAGATCAAGATGGCAACACAATTTCAATTTGGTTATAGTGAAGGAGTTGGGCCCTGCTTC
TFome clones do not contain stop codon at 3'end.
translation: MVTVREETRKGPWTEQEDLQLVCTVRLFGERRWDFIAKVSGLNRTGKSCRLRWVNYLHPGLKRGRMSPHEERLILELHARWGNRWSRIARRLPGRTDNEIKNYWRTHMRKKAQERKRNMSPSSSSSSLTYQSGYPDTPSTIGVEGQELHGGSGCITSILKGTPPDMDGYPMDQIWMEIEAPQMPSEESFVGGNHNVCSSLATPLPPPTVWEYYPDACWKVDDEIKMATQFQFGYSEGVGPCF