Tfome Clone Information

TFome Information for pUT5772

TFome Name pUT5772
Template Genomic DNA
Genbank Insert ID KJ727820
Protein Name ZmMYB57
Species Maize
TF Family MYB
Gene ID GRMZM2G102790
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: SE128_F 3' Primer Name: SE128_R
5' Primer Tm (º C): 71.8 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGCAGGTCACCGTGCTG 3' Primer Sequence: CTCTAGCAACTCTCTCCAACTGTCGCTGTTG
PCR Condition: Step 1, 98°C 3 min melt, 1 cycle; Step 2, 98&d
Nucleotide Sequence: ATGGGCAGGTCACCGTGCTGCGACCAGGACGCGGGGGTGAAGAAGGGTCCGTGGACGCCCGAGGAGGACAAGCTGCTGGTGGACTACATCAACGAGCACGGCCACGGCAGCTGGCGCCGCCTGCCCAAGCTCGCCGGCCTCAACCGCTGCGGCAAGAGCTGCCGCCTGCGATGGACCAACTACCTCCGCCCCGACATCAAGCGCGGCAGGTTCACCGACGACGAGGAAGACCTCATCGTCCACCTCCACTCCCTCCTCGGCAACAAGTGGTCCTCCATCGCCACCAAGCTCCCCGGCCGCACCGACAACGAGATCAAGAACTACTGGAACACGCACCTCCGCAAGAAGCTGCTCTCCATGGGGATCGACCCCGTCACGCACCAGCGACGCACCGACCTCAACCTCCTCGCAGCTGGCTTCCCCAGCCTCCTCGCCGCCGCCAACTTCGCGGCCGCCGCTGGTGCTCCAGCACCTACGGCGACAGGCCCACTCGCCGCCGCCCATGTTAGCAGCTGGGACATCAACGCGCTCAGGCTCCAGGCCGACGCCGCCAAGTACCAGCTCCTCGAGGGCCTCGTCCGCGTGCTCACCGCCCCCGCCGCCGCACCAACCGTCGGCCTCATGACCCTCCTCGCCGCCGCCAATGGAGGGGCGCCCAGCGGCCACCAGCAGAGCACCAGGGTCGTCCAGCAGTGCGACGGCATGCTCAGCCTGCCGGCGCTGACCAGCGTGCCGCCCGTCACGACGCCGCCGGGCACGTCCTCCGCCGCCTACTCCCTCTCCGGGCTCCTCTTCGGCGGTGCCGGCACGACGACCACCGCTCCGGCCGCCGGGGACGGGCTCAGCTCCACAGATCAGCTCGGCCACAGCGGGGCCACGACCGGGAGCAACATCACTGCCGCCGCGATGCCGCCACCTTTGTCATCAGCGGCGGCCGAGGGTTGTAATGGCGCCGGCAAAGGTTGCGGCAGGTCGACCCCATCGACGTGCGACGAGACGCCGGCGTCGAGCCCGTTCGATAGCCTGGACAGCCTCACCTTGGATTTTGACCACAACAGCGACAGTTGGAGAGAGTTGCTAGAG
TFome clones do not contain stop codon at 3'end.
translation: MGRSPCCDQDAGVKKGPWTPEEDKLLVDYINEHGHGSWRRLPKLAGLNRCGKSCRLRWTNYLRPDIKRGRFTDDEEDLIVHLHSLLGNKWSSIATKLPGRTDNEIKNYWNTHLRKKLLSMGIDPVTHQRRTDLNLLAAGFPSLLAAANFAAAAGAPAPTATGPLAAAHVSSWDINALRLQADAAKYQLLEGLVRVLTAPAAAPTVGLMTLLAAANGGAPSGHQQSTRVVQQCDGMLSLPALTSVPPVTTPPGTSSAAYSLSGLLFGGAGTTTTAPAAGDGLSSTDQLGHSGATTGSNITAAAMPPPLSSAAAEGCNGAGKGCGRSTPSTCDETPASSPFDSLDSLTLDFDHNSDSWRELLE