Tfome Clone Information

TFome Information for pUT5983

TFome Name pUT5983
Template BT066924
Genbank Insert ID KJ727890
Protein Name ZmOrphan53
Species Maize
TF Family Orphans
Gene ID GRMZM2G155954
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B913_F 3' Primer Name: B913_R
5' Primer Tm (º C): 67.1 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGTAAGAGAGGAAAGTGGTTTAG 3' Primer Sequence: GGCAGCAGGGGCATCCTT
PCR Condition: PCR Conditions: Volumes per reaction (25l): 5 l GC
Nucleotide Sequence: ATGGGTAAGAGAGGAAAGTGGTTTAGTGCGGTGAAGAAAGTCTTCAGCTCCTCCGATCCAGATGGAAAGGAAGCCAAGGCCCAGAAGGCAGACAAATCGAAATCCAAGAGGAGATGGCCATTTGGAAAGTCCAAGCACTCGGAGCCTTCCATATCGACGGTGCCAGGCACTGCTCCAGCAGTAGCTCCGTTGCCATCACCACCAGCAACTCAGCCCCACTCTCTGGAGATCAAAGATGTCAATCCAGTTGAAACAGACAGTGAGCAGAACAAGCATGCCTACTCCGTTGCGCTTGCGTCTGCTGTCGCTGCTGAAGCTGCAGCAGTTGCTGCCCAGGCTGCTGCGGAAGTTGTCCGCCTCACAGCAGTTACCACGGCTGCACCAAAGATGCCTGTTAGTTCGAGGGAAGAACTTGCCGCCACCAAGATTCAGACTGCCTTCAGGGGTTATCTGGCAAGGAGAGCATTGCGTGCACTAAGAGGGCTAGTTAGATTGAAGTCGCTTGTTGATGGAAATGCTGTCAAACGCCAAACCGCTCACACCTTGCAATGCACACAAGCAATGACAAGAGTTCAAACTCAAATCTACTCTAGAAGGGTGAAGTTGGAGGAGGAGAAACAGGCTCTTCAAAGACAACTCCAATTGAAACATCAAAGGGAACTTGAGAAAATGAAGATTGATGAAGATTGGGATCACAGCCATCAATCCAAAGAGCAAATTGAGGCCAACCTAATGATGAAACAGGAAGCTGCACTGAGGCGAGAGAGAGCACTTGCATATGCATTTTCTCACCAGTGGAGGAATTCTGGTCGAACTATAACCCCTACTTTTACGGAACCTGGGAACCCCAACTGGGGCTGGAGCTGGATGGAGCGCTGGATGACAGCAAGACCATGGGAGAGTCGGTTGGCGGCGGCATCGGACAAGGACCCTAAAGAACGTGCTGTGACAAAGAATGCGAGCACCAGTGCTGTTCGAGTACCTGTATCCCGTGCCATCTCGATTCAGAGACCAGCAACACCAAACAAGTCGAGCCGCCCACCAAGCCGGCAGTCACTTTCAACCCCGCCATCGAAGACCCCGTCAGCCTCAGGAAAGGCCAGGCCGGCAAGTCCAAGGAACAGTTGGCTGTACAAGGAGGATGACCTGAGGAGCATCACGAGCATCCGCTCCGAGCGCCCAAGGAGGCAGAGCACGGGTGGAGGCTCGGTCCGGGACGATACCAGCCTGACCAGCACACCACCTCTCCCCAGCTACATGCAGTCGACCGAGTCTGCACGGGCCAAGTCTCGGTACCGCAGTCTACTACTGACTGAGAAGCTTGAGGTTCCTGAGAGAGCGCCTCTGGCCCACTCCGTTGTCAAGAAGCGCCTGTCGTTCCCCGTCGTCGAGAAGCCAAGCGTTGTGCCGACAGAGAAGCCCAGGGAAAGAGTGAGGCGCCATTCCGACCCTCCGAAGGTCGATCCTGCGACGCTCAAGGATGCCCCTGCTGCC
TFome clones do not contain stop codon at 3'end.
translation: MGKRGKWFSAVKKVFSSSDPDGKEAKAQKADKSKSKRRWPFGKSKHSEPSISTVPGTAPAVAPLPSPPATQPHSLEIKDVNPVETDSEQNKHAYSVALASAVAAEAAAVAAQAAAEVVRLTAVTTAAPKMPVSSREELAATKIQTAFRGYLARRALRALRGLVRLKSLVDGNAVKRQTAHTLQCTQAMTRVQTQIYSRRVKLEEEKQALQRQLQLKHQRELEKMKIDEDWDHSHQSKEQIEANLMMKQEAALRRERALAYAFSHQWRNSGRTITPTFTEPGNPNWGWSWMERWMTARPWESRLAAASDKDPKERAVTKNASTSAVRVPVSRAISIQRPATPNKSSRPPSRQSLSTPPSKTPSASGKARPASPRNSWLYKEDDLRSITSIRSERPRRQSTGGGSVRDDTSLTSTPPLPSYMQSTESARAKSRYRSLLLTEKLEVPERAPLAHSVVKKRLSFPVVEKPSVVPTEKPRERVRRHSDPPKVDPATLKDAPAA