Tfome Clone Information

TFome Information for pUT5984

TFome Name pUT5984
Template BT042028
Genbank Insert ID KJ727891
Protein Name ZmOrphan335
Species Maize
TF Family Orphans
Gene ID GRMZM2G057907
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B917_F 3' Primer Name: B917_R
5' Primer Tm (º C): 69.5 3' Primer Tm (º C):
5' Primer Sequence: caccATGTGGTCGTGGTTGACGAAGATTG 3' Primer Sequence: TGATATGGCGGTTATCCCTGAGAAAC
PCR Condition: PCR Conditions: Volumes per reaction (25l): 5 l GC
Nucleotide Sequence: ATGTGGTCGTGGTTGACGAAGATTGCGTCCGCGTGCTTGGGCCCGGTCCGGAGGTGCGCGCGTACGAGGAAGGATGAGGACGACAGCGATAATGGCCGCGGCGTCGCCGACGACCTGCTGTGGTCGCGGGACCTCGGGCGCCACGCGGCGGGTCAGTTCTCGTTTGCCGTCGTGCAGGCCAACGAGGCGTTGGAGGACCACAGCCAAGTGGAGACAGGCTCTGCCGCAACTTTCGTAGGCGTCTACGACGGTCATGGCGGCGCTGAGGCTGCCCGCTTCATATCTGACCACCTCTTCGCACACCTCATTCGACTTGCTCAGGAAAATGGAACAATATCTGAGGATGTTGTTCGGAGTGCGTTTTCTGCCACCGAGGAAGGCTTCTTGACACTCGTGCGGAGAACACGTTTTATAAAGCCTTTGATTGCTGCGGTTGGATCCTGCTGTCTAGTTGGTGTCATATGGAGAGGGACACTATATGTGGCTAATCTAGGCGATTCCAGGGCTGTTATTGGCGTTCTAGGTAGATCAAACAAGATCGTGGCTGAGCCACTCACAAGAGATCATAATGCAAGTAGGGAGGAGGTCAGGCAGGAGCTTATATCCCGTCATCCAGATGATTCTCAAATTGTCGTTCTCAAGCATGGTGTTTGGCGCATCAAGGGCATAATTCAGGTTTCAAGAACAATTGGAGATGCTTACTTGAAGAGGCGGGAATTTGCTCTTGATCCATCTATCACTCGTTTCCGCCTTTCGGAGCCTCTCCGCCAGCCTATTCTCACAGCAGAGCCATCTATCTATACAAGGGTGCTTAACCCACAAGATAAATTTATTATTTTTGCATCTGATGGTCTTTGGGAGCACTTGACAAATCAACAGGCCGTTGAAATTGTCCACAGCAATCCACGATCAGGAATTGCAAAGAGGCTGGTAAGGGCAGCGTTGAAACAAGCTGCACGGAAGAGGGAAATGAGGTATGATGACCTCAGGAAAGTTGAGAAGGGAATTCGCCGCTTCTTCCACGATGACATTACAGTAGTTGTTGTTTACATAGATCACGGATTACTGCAAGAGAGGGATACTTCCGTGCCAGAGCTCTCAGTCCGTGGCTTTGTTGACTCCGTTGGCCCCTCAAGTTTCTCAGGGATAACCGCCATATCA
TFome clones do not contain stop codon at 3'end.
translation: MWSWLTKIASACLGPVRRCARTRKDEDDSDNGRGVADDLLWSRDLGRHAAGQFSFAVVQANEALEDHSQVETGSAATFVGVYDGHGGAEAARFISDHLFAHLIRLAQENGTISEDVVRSAFSATEEGFLTLVRRTRFIKPLIAAVGSCCLVGVIWRGTLYVANLGDSRAVIGVLGRSNKIVAEPLTRDHNASREEVRQELISRHPDDSQIVVLKHGVWRIKGIIQVSRTIGDAYLKRREFALDPSITRFRLSEPLRQPILTAEPSIYTRVLNPQDKFIIFASDGLWEHLTNQQAVEIVHSNPRSGIAKRLVRAALKQAARKREMRYDDLRKVEKGIRRFFHDDITVVVVYIDHGLLQERDTSVPELSVRGFVDSVGPSSFSGITAIS