Tfome Clone Information

TFome Information for pUT6016

TFome Name pUT6016
Template BT066884.1
Genbank Insert ID KJ727921
Protein Name ZmMADS38
Species Maize
TF Family MADS
Gene ID GRMZM2G334225
transcript T03
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B610_F 3' Primer Name: B610_R
5' Primer Tm (º C): 67.2 3' Primer Tm (º C):
5' Primer Sequence: caccATGAAGATGCTTGCTAAACTCAAATGTG 3' Primer Sequence: GCCAATGTTGACCACCCCGG
PCR Condition: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l pr
Nucleotide Sequence: ATGAAGATGCTTGCTAAACTCAAATGTGAGGGTAACATAGCCGAACAACTCACACCTAATAAAGAGCCAATAAATTCCAACGTAGAGGAGCTTCAGCAGGAGATTAAGACGTACCAACACCAGATGGAAGTCTTAAAGGAGCAACTTAGGATGTTCGAACCAGATCTGACAACATTGATGTCGATGAACGATTTCGAGACGTGTGAGAAATTCCTCATGGACACCCTCACTTGCGTGGAGGAGCGAAAGAAATATTTGCTGTGCAACCACGTGGCCCCGTTCGATCCGTCGGCCTCCGACATGCAACAACACGTAGACATGTTCGCCCTGCCGCCGGCGCCGCCTCACCAACAGGAGCAACAAGGGGACGACCTAGGAGGCGCCGCCAGCGCGTTCGGTGGCGATGTCTCGTGGTTCGCCGATGGGATGCCGACGTCGTCGATCTTTGCCGCGTCGGACCCAATCTTGTACTTTAGGGATCAGGTGATGTTCGACTCGACGTCGACGATGCGGCGTGACTCGATGGTGGCAGGGGTGGACCCAGGAATGACCTCGGTGTGCCAGATGGAGCAGCAAGCCCCCAGCGTGGACTGGCAGCAGGCGTACACGTCGGCGGAGTTCTTCTCCACGCTGATCCCGTCCACGCCCTACCCCCTTGATGATCAGATGCAGAACGACATGGCTCAAGTGCTTACATCTCCGATGGTGCCACCGCACGAGCACGATAAGGTGGAGGTGCCGATGAGCTCGTCCAACGTGCCGACGGACGGGGATTGCGGCACCACCCTTGCCGCCGCTCAAGAGGACGGCCTGCCCGGGGTGGTCAACATTGGC
TFome clones do not contain stop codon at 3'end.
translation: MKMLAKLKCEGNIAEQLTPNKEPINSNVEELQQEIKTYQHQMEVLKEQLRMFEPDLTTLMSMNDFETCEKFLMDTLTCVEERKKYLLCNHVAPFDPSASDMQQHVDMFALPPAPPHQQEQQGDDLGGAASAFGGDVSWFADGMPTSSIFAASDPILYFRDQVMFDSTSTMRRDSMVAGVDPGMTSVCQMEQQAPSVDWQQAYTSAEFFSTLIPSTPYPLDDQMQNDMAQVLTSPMVPPHEHDKVEVPMSSSNVPTDGDCGTTLAAAQEDGLPGVVNIG