Tfome Clone Information

TFome Information for pUT6123

TFome Name pUT6123
Template BT085811.1
Genbank Insert ID KJ727999
Protein Name ZmTUB14
Species Maize
TF Family TUB
Gene ID GRMZM2G001272
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGTCTTTCCGCAGCATTGTGCGTGATGTAAGAGATGGCTTTGGGAGCTTGTCTCGAAGAGGGTTTGAGGTGAAGTTTCTGGGCCACCGCCGAGGCAGATCTCACGGTGCTGTCCATGAGCTGCGTGATCCAGCCCCAGTGATCCAGAGCAGTTGCTGGGCTAATTTGCCCCCTGAATTGCTTCGAGATGTGATTGAGAGGTTGGAGGCCAGTGAAGCCACATGGCCTAACAGGAAGAGTGTAGTCTCTTGTGCAGCTGTTTGTCGGACCTGGAGAGAAATCTGCAAAGAGATCGTTAAGAATCCAGAGTTCTCTGGAAAAATCACTTTTCCTGTGTCCTTAAAGCAGCCTGGGCCTCGAGATGTAACCATCCAATGCTTCATCAAAAGGGATAAATCTACTCAAACCTACTACTTGTATCTGTGCCTTAGCACAGCTGTGCTTGTTGAAAGTGGCAAGTTCCTCCTATGTGCGAAACGGACCTCCCGCCCAACCTGTACAGAATATACAATATTTATGAATTCTGAAAATTTATCTAGGTCAAGCAAAATGTACATTGGAAAGCTGAGGTCGAATCTCCTCGGCACAAAGTTTGCAATATATGATACCCAGCCCCCATGCAATGCAGCAGAACCCGGGAAAACAAGCCGTCGGTTCTACTCCCGGAAGGTGTCGCCAAAGGTCTCCTCCAGCACCTACAACATAGCGCAGGTTTCATATGAGCTGAATGTCTTGGGTACTCGGGGCCCTAGGCGGATGAACTGTGTTATGCACTCCATCCCTACCTCGTGCCTTGAGGCTGGTGGCACTGTTCCCAGCCAGCTGGACAGCATCCTTGCTCGCTCTACTGATGAGTCATTTGGCAGCATTTCCTTCTCCAAGTCATCTGTTGTGGACCGGTCTATGCGTTTCAGCAGCTCAAGATTCTCCGACATCTCAATGAGCAGCAGCCGCAGGATTGGAGACACGGCATCGGGAGACAATGATGAGTGCAAGGAGAGGCCATTGATTCTCCGGAACAAGGCCCCAAGGTGGCACGAGCAGCTGCAGTGCTGGTGCCTCAATTTCAGGGGCAGGGTGACAGTCGCATCTGTGAAGAACTTCCAGCTCGTTGCTGCCACGCAGCCCGCTGCTGGAGCACCAACCCCATCACAGGCTACCCCAGTGCCGCCCGAGCACGAGAAGGTGATCCTGCAATTTGGGAAGGTGGCTAAGGACATGTTCACCATGGACTACCGTTACCCACTGTCAGCCTTCCAGGCCTTCGCGATCTGCCTGAGCAGCTTCGACACCAAGCTGGCCTGCGAA
TFome clones do not contain stop codon at 3'end.
translation: MSFRSIVRDVRDGFGSLSRRGFEVKFLGHRRGRSHGAVHELRDPAPVIQSSCWANLPPELLRDVIERLEASEATWPNRKSVVSCAAVCRTWREICKEIVKNPEFSGKITFPVSLKQPGPRDVTIQCFIKRDKSTQTYYLYLCLSTAVLVESGKFLLCAKRTSRPTCTEYTIFMNSENLSRSSKMYIGKLRSNLLGTKFAIYDTQPPCNAAEPGKTSRRFYSRKVSPKVSSSTYNIAQVSYELNVLGTRGPRRMNCVMHSIPTSCLEAGGTVPSQLDSILARSTDESFGSISFSKSSVVDRSMRFSSSRFSDISMSSSRRIGDTASGDNDECKERPLILRNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLVAATQPAAGAPTPSQATPVPPEHEKVILQFGKVAKDMFTMDYRYPLSAFQAFAICLSSFDTKLACE