Tfome Clone Information

TFome Information for pUT6439

TFome Name pUT6439
Template Synthesized template
Genbank Insert ID KJ728169
Protein Name ZmMYB97
Species Maize
TF Family MYB
Gene ID GRMZM2G162434
transcript T01
Vector pENTR/SD/D-TOPO
Note Synthesized with a stop codon
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGCAGGCCGCCATGCTGCGATAAGGAGGGCATTAAGAAGGGCCCCTGGACCCCAGAGGAGGACATCATCCTGGTCAGCTACATCCAAGAGCACGGCCCAGGCAACTGGCGCTCTGTGCCAATCAACACTGGCCTGATGAGGTGCAGCAAGAGCTGCAGGCTGAGGTGGACCAACTACCTGAGGCCAGGCATTAGGCGCGGCAACTTCACTCCACACGAGGAGGCCATCATCGTCCACCTCCAATCTCTGCTGGGCAACAGGTGGGCTGCTATCGCTTCTTACCTGCCGCAGAGGACCGACAACGACATCAAGAACTACTGGAACACCCACCTGAAGAAGAAGCTGAAGAAGCAGCAGGCCATCGGCGCCATCTTCGCTCCACCAGACTCTAGCAGCAGCAGCTCCTCTATCGTGGTGCCACCAGCTGCTACCACCACCACCACTACCGTGGATCACCACCACAGGGATATGCTGGGCGCTAACCTGCTGGTGAGCAGCAAGGACACCTACTACTACGCCAGGCCACCAGCTGAGGCTGCTGCTGTTGCTAGAAGGTCCCCATTCGCTGCTGACGGCGACAGCAGCTCTAGCAGCTACGCTAGCAGCATGGACAACATCAGCAGGCTGCTGACCGGCTTCATGAAGCAGCAGCACGATGATGCTGCCGCCGCTGCTGATACAAAGCCACCAGCTCCAGCTGCCCAGGTGAACTCTCCGCCTCCAGCTGCTTTCCTGAGCCCATCTTTCCACCACCACATGTCTGCTGGCACCGGCTCTGGCACTCCACCAGCTGCATCTGCCGCTTACTTCAACGACATGATGCCGCCACCTCCGCCACAGCAGCAAGCTGCTCTTATGGGCGGCCACGGCGATTACGATGACGGCCCATCTTCTAGGCAGCACCTCCAGCCATCTCCGCTGAGCCCAATCGAGAAGTGGCTGTTCGAGGAGGCCGCTGAGCAGGTTGGCGATCTGATGGACCTGTCTGAGGACTGCTGCAGCTCCGTGCCGATGATGTTCTGA
TFome clones do not contain stop codon at 3'end.
translation: MGRPPCCDKEGIKKGPWTPEEDIILVSYIQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYLRPGIRRGNFTPHEEAIIVHLQSLLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKLKKQQAIGAIFAPPDSSSSSSSIVVPPAATTTTTTVDHHHRDMLGANLLVSSKDTYYYARPPAEAAAVARRSPFAADGDSSSSSYASSMDNISRLLTGFMKQQHDDAAAAADTKPPAPAAQVNSPPPAAFLSPSFHHHMSAGTGSGTPPAASAAYFNDMMPPPPPQQQAALMGGHGDYDDGPSSRQHLQPSPLSPIEKWLFEEAAEQVGDLMDLSEDCCSSVPMMF*