Tfome Clone Information

TFome Information for pUT6495

TFome Name pUT6495
Template BT060797
Genbank Insert ID KJ728218
Protein Name ZmOrphan89
Species Maize
TF Family Orphans
Gene ID GRMZM2G108309
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B903_F 3' Primer Name: B903_R
5' Primer Tm (º C): 66.5 3' Primer Tm (º C):
5' Primer Sequence: caccATGCTATCAGCTCTGATGGATTATTTG 3' Primer Sequence: GTAGGAGTTGTTTAGCTCTGTAGGAACC
PCR Condition: PCR Conditions: Volumes per reaction (25l): 5 l GC
Nucleotide Sequence: ATGCTATCAGCTCTGATGGATTATTTGAAATCTTGCTGGGGTCCGGCATCACCGGCTGGGCGTCCCCGCAAAGGATCGGATGCCACCGGCCGCCAGGACGGGCTCCTGTGGTACAAGGACGGCGGGCAGGTCGTCGATGGTGAGTTCTCCATGGCCGTGGTCCAGGCCAATAACCTATTGGAGGACCATAGCCAGGTTGAATCCGGGCCGCTTAGCACATCGGAGCCTGGACTGCAAGGCACCTTCGTCGGGGTCTACGATGGGCACGGTGGCCCGGAGACAGCGCGTTACATCAATGACCATCTCTTCAACCACTTGAGGAGATTCGCATCTGAGCACAAGTGCATGTCAGCGGATGTGATTCGGAAGGCATTCCGAGCGACTGAGGAGGGTTTCATTTCTGTGGTTAGTAACCAATGGTCATTGAGACCTCAATTAGCAGCTGTAGGCTCTTGCTGTCTAGTTGGTGTGGTTTGCAGCGGAACTCTATATGTTGCAAACCTTGGGGACTCCCGTGCTGTTCTGGGGAGACTTGTCAAGGGAACTGGGGAGGTTTTGGCAATGCAGCTCTCAGCAGAACACAATGCATCCTATGAGGAGGTTAGACGAGAGCTGCAGGCATCACATCCTGATGATCCCCATATTGTGGTCCTAAAACACAATGTTTGGCGTGTAAAGGGTATTATCCAGATAACAAGGTCAATTGGAGATGTGTATCTGAAGAAACCAGAATTTAATAGAGAACCTTTGCACAGCAAGTTTCGTCTTCAGGAAACTTTTAGGAGACCACTTCTTAGTTCTGATCCAGCAATTACTGTCCACCAAATACAGCCAACTGATAAGTTCATCATTTTTGCATCTGATGGACTCTGGGAACATCTTAGTAATCAGGAAGTGGTTGACATGGTCCAAAGTAGCCCGCGTAATGGAATCGCACGAAAGTTAGTAAAGTCTGCAGTGCAGGAAGCAGCGAAGAAGAGGGAGATGCGGTATTCAGACCTCAAGAAAGTTGATCGGGGGGTGAGGCGGCACTTCCACGACGATATAACTGTCATTGTGGTATTTTTCGATTCAAACGCCATGACAACTGCTGCCTGGAGCAGACCCTCGGTCTCTCTCCGAGGGGGTGGGTTTCCAATCCATTCAAACACCCTTGCTCCATTCTCGGTTCCTACAGAGCTAAACAACTCCTAC
TFome clones do not contain stop codon at 3'end.
translation: MLSALMDYLKSCWGPASPAGRPRKGSDATGRQDGLLWYKDGGQVVDGEFSMAVVQANNLLEDHSQVESGPLSTSEPGLQGTFVGVYDGHGGPETARYINDHLFNHLRRFASEHKCMSADVIRKAFRATEEGFISVVSNQWSLRPQLAAVGSCCLVGVVCSGTLYVANLGDSRAVLGRLVKGTGEVLAMQLSAEHNASYEEVRRELQASHPDDPHIVVLKHNVWRVKGIIQITRSIGDVYLKKPEFNREPLHSKFRLQETFRRPLLSSDPAITVHQIQPTDKFIIFASDGLWEHLSNQEVVDMVQSSPRNGIARKLVKSAVQEAAKKREMRYSDLKKVDRGVRRHFHDDITVIVVFFDSNAMTTAAWSRPSVSLRGGGFPIHSNTLAPFSVPTELNNSY