Tfome Clone Information

TFome Information for pUT6504

TFome Name pUT6504
Template BT085716
Genbank Insert ID KJ728227
Protein Name ZmOrphan28
Species Maize
TF Family Orphans
Gene ID GRMZM2G155370
transcript T01
Vector pENTR/SD/D-TOPO
Note c.G858A p.P286(=). Not present in template FlcDNA. Not in functional domain.
Request Information: Deposited to ABRC
5' Primer Name: C509_F 3' Primer Name: C509_R
5' Primer Tm (º C): 68.6 3' Primer Tm (º C):
5' Primer Sequence: caccATGTCGTCTTCCTGCATACCGA 3' Primer Sequence: GGTCTCTTCCTCCAGGGCCTG
PCR Condition: PCR Conditions: Volumes per reaction (25l): 5 l GC
Nucleotide Sequence: ATGTCGTCTTCCTGCATACCGACCGGCCTGCGGCTGGACCTGGACATGGTGAAGGCGGCGGCGTCGCCGGTGGGCGCGCACTCGTCGCCGCTGCGCCCGGCGCACTACTCGTCGCCGTCGTCGACGCTGTCGTCGGAGGCGTCCAACGCCTCGTCATCGTCGGCGACGTCGGTGTCGCTCAAGCGGGCTCGCGCGCCGCGGAAGCGGCCCAACCAGGCGTACAACGAGGCCGCCGCGCTGCTCGCGTCCATCCACCCCTCCGTGTTCCCCGTGAACAAGAGCCCCAAGACGGCGCCGCCGCGCCCGCCGCAGCTCTCCGTGCTGGCGGCGGCGCTCGACGCCTCGCCCGACCTCCTCCCGCCGCTCCCCGTCCTCGCGGACTCCGCATTCCTGCTCCGGGACCAGGACACGCCGTCGCCGAAGCCGCGGAGCCCGTCCGGCGCCAAGAACTGCCCGTCGCCGGCCCCCGTGAGCAGCGCGTTCCGGGACTTCCGCGACCCGCCGTCGTCGGCGAGCCTCGACGCGGTCGGCGCCGACGAGCTTGGCGAGATCGACTTCGACGACGACGGCTTCAACGCCGACTCCATCCTCGACGTCGGTGACGCCGCGGCCGGGGGCCTCGACGGCATCATGGGCAGCCTCACCGTCGACGTCGAGAGCGGCACCGCCGCCAGGTCCGATGACTCCATCCTTTCCAGCTCCGGCATACACCCCTACCTCAGGAGGCTCATGGTGGTCGGCCTCGCCGGCAGGTTCGAGCTCGGCCTCGGGTCCCAGCACGGTGCTCGGCCCAGCCTCAACCGCGCACTGAAGCGGCGGGACGACGACGGCGCCTGGTGGATGTGGCCGGCAGTGCCAGTAAAGGACTTGACGATCGCACCACCGGCACCGCCAGCACCACCGGCGCCGAACGCCGCAGTGCCGCAGGCCGCCGCCGCCGCCGCGCCAGAAAAGAAGAAAAGCAAGAAGAAGAAGGTGGTGAAGGCCATGGCGAAGGGAAATGAGGAGCTTCTTCCCAACGCGAAGTGCAAGGAGGAAGAAGCTGACGCCTCTGTTGATGACGCCGCCGCTAATGGCGACGGTGACTCCGACAGTGCGCCGACGAACGCACCAAAGGCCGGTCTGGGGCTGAAGCTGGACGCCGACGAGGTTCTCAAGGCGTGGTCCGACAAAGGGTCCATGTTTGCCGAGGGCAGCGGGCCGGAGTTGCCGACGTCGGCCGCCGAAGTGCGGGCTAAGCTTGCAGACATCGACCTGTTTCCAGAGAACGGAGCAGGCGGCGGTGGGGTCAGGGAAGCCAGCGTGCTGCGGTACAAGGAGAAGAGGCGCACCCGGCTCTTCTCCAAGAAGATCCGGTACCAGGTGCGCAAGGTGAACGCCGACTGCCGGCCTCGGATGAAGGGAAGGTTCGTTAGGAGCCCGTCTCTTCTTCGGCAGGCCCTGGAGGAAGAGACC
TFome clones do not contain stop codon at 3'end.
translation: MSSSCIPTGLRLDLDMVKAAASPVGAHSSPLRPAHYSSPSSTLSSEASNASSSSATSVSLKRARAPRKRPNQAYNEAAALLASIHPSVFPVNKSPKTAPPRPPQLSVLAAALDASPDLLPPLPVLADSAFLLRDQDTPSPKPRSPSGAKNCPSPAPVSSAFRDFRDPPSSASLDAVGADELGEIDFDDDGFNADSILDVGDAAAGGLDGIMGSLTVDVESGTAARSDDSILSSSGIHPYLRRLMVVGLAGRFELGLGSQHGARPSLNRALKRRDDDGAWWMWPAVPVKDLTIAPPAPPAPPAPNAAVPQAAAAAAPEKKKSKKKKVVKAMAKGNEELLPNAKCKEEEADASVDDAAANGDGDSDSAPTNAPKAGLGLKLDADEVLKAWSDKGSMFAEGSGPELPTSAAEVRAKLADIDLFPENGAGGGGVREASVLRYKEKRRTRLFSKKIRYQVRKVNADCRPRMKGRFVRSPSLLRQALEEET