Tfome Clone Information

TFome Information for pUT6662

TFome Name pUT6662
Template BT038859.1
Genbank Insert ID KJ728380
Protein Name ZmALF6
Species Maize
TF Family Alfin-like
Gene ID GRMZM2G115424
transcript T03
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: C206_F 3' Primer Name: C206_R
5' Primer Tm (º C): 72.3 3' Primer Tm (º C):
5' Primer Sequence: caccATGGACGGCGGGGGCTC 3' Primer Sequence: CGCCCTGACCCTCTTGTTGGTGC
PCR Condition: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l pr
Nucleotide Sequence: ATGGACGGAGGAGCCGGCTTCCCTGGCACGCCGGTCCCGCGCTCGCCGGAGGACGTTTTCCGGGACTACCGCGCGCGCCAGGCCGGCCTAATCAGGGCGCTCACCACCGATGTTGAGAAGTTCTACGTGATGTGCGACCCAGAGAAGGATAATTTATGTTTATATGGACTTCCCAATGAGACATGGGAAGTAAACTTGCCTGCTGAGGAGGTTCCTCCTGAACTCCCAGAGCCAGCTCTCGGAATTAATTTTGCTCGTGATGGGATGAATGAAAAAGATTGGCTATCACTTGTTGCAGTGCATAGTGATTCTTGGCTAATGTCTGTTGCATTTTATTTTGGAGCAAGGTTTGGATTCGACAAGGAATCCAGGAAACGTCTCTTCACCATGATCAATAATCTTCCCAGCATATATGAGGTTGTCACAGGAACAGCCAAGAAAGAGTCCAAAGAAAAAACTCCTAAAAGCAGCAACAAGACTAACAAATCTGGCTCAAAGCCTTCACGCCAGGTAGAACCCAACTCCAGGGTCCCAAAGATGCCACCTCCAAAGGACGAGGAGAGTGAAGGGGAGGAAGGTGAACCACAGGAAGACCATGAGAGTGCGCTGTGCGGCGCATGTGGCCTAGGTTATGACGACTTCTGGATCTGTTGCGACTTATGCGAGACATGGTTCCACGGCAAGTGTGTCAAGATCACCCCAAATAAAGCGGAGCACATCAAGCAGTATAAGTGCCCCTCGTGCACAGGAAGCAAGAGGGCCAAGGCT
TFome clones do not contain stop codon at 3'end.
translation: MDGGAGFPGTPVPRSPEDVFRDYRARQAGLIRALTTDVEKFYVMCDPEKDNLCLYGLPNETWEVNLPAEEVPPELPEPALGINFARDGMNEKDWLSLVAVHSDSWLMSVAFYFGARFGFDKESRKRLFTMINNLPSIYEVVTGTAKKESKEKTPKSSNKTNKSGSKPSRQVEPNSRVPKMPPPKDEESEGEEGEPQEDHESALCGACGLGYDDFWICCDLCETWFHGKCVKITPNKAEHIKQYKCPSCTGSKRAKA