Tfome Clone Information

TFome Information for pUT6667

TFome Name pUT6667
Template BT037009.1
Genbank Insert ID KJ728384
Protein Name ZmHB94
Species Maize
TF Family Homeobox
Gene ID GRMZM2G108933
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B501_F 3' Primer Name: B501_R
5' Primer Tm (º C): 71.5 3' Primer Tm (º C):
5' Primer Sequence: caccATGGAGACGCCACAGCAGCAA 3' Primer Sequence: GCGGCCTCCGGAGGACTGGA
PCR Condition: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l pr
Nucleotide Sequence: ATGGAGACGCCACAGCAGCAATCCGCCGCCGCCGCCGCCGCCGCCGCCCACGGGCAGGACGACGGCGGGTCGCCGCCGATGTCGCCGGCCTCCGCCGCGGCGGCGGCGCTGGCGAACGCGCGGTGGAACCCGACCAAGGAGCAGGTGGCCGTGCTGGAGGGGCTGTACGAGCACGGCCTGCGCACCCCCAGCGCGGAGCAGATACAGCAGATCACGGGCAGGCTGCGGGAGCACGGCGCCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCCAGCGCCAGAGGCAGAAGCAGGACAGCTTCGCCTACTTCAGCAGGCTCCTCCGCCGGCCCCCGCCGCTGCCCGTGCTCTCCATGCCCCCCGCGCCACCGTACCATCACGCCCGCGTCCCGGCGCCGCCCGCGATACCGATGCCGATGGCGCCGCCGCCGCCCGCTGCATGCAACGACAACGGCGGCGCGCGTGTGATCTACAGGAACCCATTCTACGTGGCTGCGCCGCAGGCGCCCCCTGCAAATGCCGCCTACTACTACCCACAGCCACAGCAGCAGCAGCAGCAGCAGGTGACAGTCATGTACCAGTACCCGAGAATGGAGGTAGCCGGCCAGGACAAGATGATGACCAGGGCCGCGGCGCACCAGCAGCAGCAGCACAACGGCGCCGGGCAACAACCGGGACGCGCCGGCCACCCCAGCCGCGAGACGCTCCAGCTGTTCCCGCTCCAGCCCACCTTCGTGCTGCGGCACGACAAGGGGCGCGCCGCCAACGGCAGTAATAACGACTCCCTGACGTCGACGTCGACGGCGACTGCGACAGCGACAGCGACAGCGACAGCGTCCGCTTCCATCTCCGAGGACTCGGATGGCCTGGAGAGCGGCAGCTCCGGCAAGGGCGTCGAGGAGGCGCCCGCGCTGCCGTTCTATGACTTCTTCGGGCTCCAGTCCTCCGGAGGCCGC
TFome clones do not contain stop codon at 3'end.
translation: METPQQQSAAAAAAAAHGQDDGGSPPMSPASAAAAALANARWNPTKEQVAVLEGLYEHGLRTPSAEQIQQITGRLREHGAIEGKNVFYWFQNHKARQRQRQKQDSFAYFSRLLRRPPPLPVLSMPPAPPYHHARVPAPPAIPMPMAPPPPAACNDNGGARVIYRNPFYVAAPQAPPANAAYYYPQPQQQQQQQVTVMYQYPRMEVAGQDKMMTRAAAHQQQQHNGAGQQPGRAGHPSRETLQLFPLQPTFVLRHDKGRAANGSNNDSLTSTSTATATATATATASASISEDSDGLESGSSGKGVEEAPALPFYDFFGLQSSGGR