Tfome Clone Information

TFome Information for pUT6679

TFome Name pUT6679
Template DV020423
Genbank Insert ID KJ728395
Protein Name ZmMYB3
Species Maize
TF Family MYB
Gene ID GRMZM2G084799
transcript T01
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: B295_F 3' Primer Name: B295_R
5' Primer Tm (º C): 77.8 3' Primer Tm (º C):
5' Primer Sequence: caccATGGGGAGGGCGCCGTGCTGCG 3' Primer Sequence: GAACGAGTCGGACAGGAG
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer f
Nucleotide Sequence: ATGGGGAGGGCGCCGTGCTGCGAGAAGGTGGGGCTCAAGCGAGGGAGGTGGACGGCGGAAGAGGACCAGTTACTTGCCAACTACATTGCGGAGCACGGCGAGGGGTCCTGGAGGTCGCTGCCCAAGAATGCAGGCCTGCTCCGGTGCGGCAAGAGCTGCCGGCTCCGGTGGATCAACTACCTTCGGGCGGACGTCAAGAGGGGGAACATCTCCAAGGAGGAAGAAGACATCATCATCAAGCTCCACGCCACCCTCGGCAACAGGTGGTCCCTGATCGCCAGCCACCTCCCCGGCCGAACAGACAACGAGATCAAGAACTACTGGAACTCGCACCTCAGCCGGCAGATCCACACGTACCGCCGGAAATACACCGCCGGGCCTGACGACACCGCCATCGCCATCGACATGAGCAAGCTGCAGAGCGCCGACAGGCGGCGCGGCGGCAGGACCCCGGGCCGGCCGCCGAAGGCTAGCGCCAGCAGGACCAAGCAGGCGGACGCCGATCAGCCCGGCGGCGAGGCGAAAGGCCCGGCCGCGGCGGCGTCGAGCCCGCGGCACAGCGACGTGGTGAACCCGGGCCCGAACCAGCCCAACAGCAGCAGCGGCAGCACGGGCACGGCCGAGGAGGAGGGGCCCAGCAGCGAGGACGCGAGCGGGCCGTGGGTGCTGGAGCCGATAGAGCTCGGGGACCTAGTCTGGGGGGAGGCCGACAGCGAGATGGACGCCCTGATGCCTATCGGGCCCGGCGGCCACGACTCGGCTGCCCTCGAAGGGCTTGGCGCGGTCGGCTGCGAGGCCCAGGTGGACGACCTGTTCGACATGGACTGGGATGGCTTCGCGGCCCATCTGTGGGGCGGGCCGGAGCAGGACGAGCACAGCGCGCAGCTGCGGCAGGCCGCCGAGCCGCTGGAAGTTGCTGCTGCTGCTGCTGCTGCGACGGCGGCCCGCACCCCGGACGATCGCGAGCTGGAGGCGTTCGAGACTTGGCTCCTGTCCGACTCGTTC
TFome clones do not contain stop codon at 3'end.
translation: MGRAPCCEKVGLKRGRWTAEEDQLLANYIAEHGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADVKRGNISKEEEDIIIKLHATLGNRWSLIASHLPGRTDNEIKNYWNSHLSRQIHTYRRKYTAGPDDTAIAIDMSKLQSADRRRGGRTPGRPPKASASRTKQADADQPGGEAKGPAAAASSPRHSDVVNPGPNQPNSSSGSTGTAEEEGPSSEDASGPWVLEPIELGDLVWGEADSEMDALMPIGPGGHDSAALEGLGAVGCEAQVDDLFDMDWDGFAAHLWGGPEQDEHSAQLRQAAEPLEVAAAAAAATAARTPDDRELEAFETWLLSDSF