Tfome Clone Information

TFome Information for pUT6786

TFome Name pUT6786
Template Synthesized template
Genbank Insert ID KJ728481
Protein Name ZmMYB46
Species Maize
TF Family MYB
Gene ID GRMZM2G308034
transcript T02
Vector pENTR/SD/D-TOPO
Note
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGGAGGCCGCCGTGCTGCGACAAGGCGAACGTGAAGAAGGGGCCGTGGACGCCGGAGGAGGACGCCAAGCTGCTGGCCTACACCTCCACCCATGGCACCGGCAACTGGACCAACGTGCCCCAACGAGCAGGTGATCGTGCCGCCGTGCACCATGCATTTTGTTGTTTTGTTTGTGGCTCA
TFome clones do not contain stop codon at 3'end.
translation: MGRPPCCDKANVKKGPWTPEEDAKLLAYTSTHGTGNWTNVPQRAGDRAAVHHAFCCFVCGS