Tfome Clone Information

TFome Information for pUT6818

TFome Name pUT6818
Template Synthesized template
Genbank Insert ID KJ728513
Protein Name ZmMYB131
Species Maize
TF Family MYB
Gene ID GRMZM2G001875
transcript T01
Vector pENTR/SD/D-TOPO
Note This construct was synthesized with codon optimization for yeast.
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGTAGAACTCCATGTTGTGATAGAGCTGCTGTTAAGAGAGGTCCTTGGTCACCTGAAGAAGATGAAGCTTTGAGATCTTACGTTCAAAGACATGGTTCTGGTGGTAACTGGATTACTATGCCAAAAAAAGCTGGTTTGAAGAGATGTGGTAAGTCCTGTAGATTGAGATGGTTGAACTACTTAAGACCAGATATCAGACATGGTGGTTTCACTGCCGAAGAAGATGCTGTTATTATGTCCTTGTATGCCCAATTGGGTTCTAAGTGGTCTTTGATTGCTTCTCAAATGGAAGGTAGAACCGATAACGATGTTAAGAATCATTGGAACACCAAGTTGAAGAAGAGATTATTGGCTGCTGCTGCTGCATCTTCTGCTCCACCACCAGCTCCAGCTCCAGCACCATTATCTTCTACTACTTTGACTTCTTCCTTGTTCCCATCTTTGGCTATTCCAACTGTTAAGACTGAAGCTTACACCTGTGATGATTTTTTGGCTCCAGCTTTGGGTTTGGGTGATCCATTTGCTGCTGCAGCTGCTGCTGCCGATGGTTCTACTTCTGCTGCTTCTGCAGCTTCATCTGCTTCTAACAATTGGTCTGCTGCTGAAAATGGTGCTGGTGAAGCTTCTTTGTTTTTGTTGGATTTTTGTGCCGGTCCAGATTTGGCTGGTGCTGATCAATTGCATTTGCCAGGTGGTTATTACTATCCATTGGATCCTATTTTGCCATCCTCTCCAAGAAGATACTCTTAA
TFome clones do not contain stop codon at 3'end.
translation: MGRTPCCDRAAVKRGPWSPEEDEALRSYVQRHGSGGNWITMPKKAGLKRCGKSCRLRWLNYLRPDIRHGGFTAEEDAVIMSLYAQLGSKWSLIASQMEGRTDNDVKNHWNTKLKKRLLAAAAASSAPPPAPAPAPLSSTTLTSSLFPSLAIPTVKTEAYTCDDFLAPALGLGDPFAAAAAAADGSTSAASAASSASNNWSAAENGAGEASLFLLDFCAGPDLAGADQLHLPGGYYYPLDPILPSSPRRYS*