Tfome Clone Information

TFome Information for pUT6820

TFome Name pUT6820
Template Synthesized template
Genbank Insert ID KJ728515
Protein Name ZmMYB97
Species Maize
TF Family MYB
Gene ID GRMZM2G162434
transcript T01
Vector pENTR/SD/D-TOPO
Note This construct was synthesized with codon optimization between maize and yeast.
Request Information: Deposited to ABRC
5' Primer Name: 3' Primer Name:
5' Primer Tm (º C): 3' Primer Tm (º C):
5' Primer Sequence: 3' Primer Sequence:
PCR Condition:
Nucleotide Sequence: ATGGGTAGACCACCATGCTGCGATAAGGAAGGTATCAAGAAGGGCCCTTGGACCCCAGAAGAAGATATCATCTTGGTTTCTTACATCCAAGAACATGGTCCAGGCAATTGGAGATCTGTTCCAATCAACACCGGTTTGATGAGATGCTCTAAGTCTTGCAGATTGAGATGGACCAACTACTTGAGGCCAGGTATCAGAAGAGGCAACTTCACCCCACATGAAGAAGCTATCATCGTTCACTTGCAATCTTTGTTGGGTAACAGATGGGCTGCTATCGCTTCTTACTTGCCACAAAGAACCGATAACGATATCAAGAACTACTGGAACACCCACTTGAAGAAGAAGTTGAAGAAGCAACAAGCTATCGGCGCTATCTTCGCTCCTCCAGATTCTTCTTCTTCATCATCTTCTATCGTTGTTCCACCAGCTGCTACCACCACCACCACTACCGTTGATCATCATCATAGAGATATGTTGGGTGCCAACTTGTTGGTTTCTTCTAAGGATACCTACTACTACGCTAGACCACCAGCTGAAGCTGCTGCTGTTGCTAGAAGATCTCCATTCGCTGCTGATGGTGACTCTTCTTCTTCCTCTTACGCATCTTCTATGGACAACATCTCTAGATTGCTTACCGGTTTCATGAAGCAACAACATGATGATGCTGCTGCCGCTGCTGATACCAAGCCACCAGCTCCAGCTGCTCAAGTTAACTCTCCACCACCAGCCGCTTTCTTGTCTCCATCTTTCCATCATCATATGTCTGCTGGTACTGGTTCTGGTACTCCACCAGCCGCCTCTGCTGCTTACTTCAACGATATGATGCCACCACCACCTCCACAACAACAAGCTGCTTTGATGGGTGGTCATGGTGATTACGATGATGGTCCATCTTCTAGACAACACTTGCAACCATCTCCATTGTCTCCAATCGAAAAGTGGTTGTTCGAAGAAGCTGCTGAACAAGTTGGTGATTTGATGGATTTGTCTGAAGATTGCTGCTCCTCTGTTCCAATGATGTTCTGA
TFome clones do not contain stop codon at 3'end.
translation: MGRPPCCDKEGIKKGPWTPEEDIILVSYIQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYLRPGIRRGNFTPHEEAIIVHLQSLLGNRWAAIASYLPQRTDNDIKNYWNTHLKKKLKKQQAIGAIFAPPDSSSSSSSIVVPPAATTTTTTVDHHHRDMLGANLLVSSKDTYYYARPPAEAAAVARRSPFAADGDSSSSSYASSMDNISRLLTGFMKQQHDDAAAAADTKPPAPAAQVNSPPPAAFLSPSFHHHMSAGTGSGTPPAASAAYFNDMMPPPPPQQQAALMGGHGDYDDGPSSRQHLQPSPLSPIEKWLFEEAAEQVGDLMDLSEDCCSSVPMMF*